(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE335

CP002031.PE335       Location/Qualifiers
FT   CDS_pept        complement(366948..367220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0337"
FT                   /product="FlhB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83200"
FT                   /protein_id="ADI83200.1"
FT                   /translation="MTTNDRDRKAVALSYREGHYAPQVVAKGYGVTAEAIIACAREAGV
FT                   YVHQSPELVRQLIQVDIDSCIPADLYRAVAELLAWLYWLEHAEGD"
     atgacgacga atgaccggga ccgcaaggct gtagccctca gctaccgcga agggcactac        60
     gccccccagg tggtggccaa ggggtacggc gtcaccgcag aggccatcat cgcctgcgcc       120
     cgagaggccg gagtctacgt ccaccagtcg ccggaactgg tacgccagct catccaggtc       180
     gacatcgact cctgcatccc ggccgatctc taccgggccg tggctgagct tctggcttgg       240
     ctctattggc tggaacacgc ggaaggcgac tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page