(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE336

CP002031.PE336       Location/Qualifiers
FT   CDS_pept        complement(367207..368964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0338"
FT                   /product="FliK domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83201"
FT                   /protein_id="ADI83201.1"
FT                   /translation="MIVTQEIARIAQALLKDSTYSLVEARWQTLTPLNLTPGQMVQAEV
FT                   LANLPDSRYLIRLANQLLRMEIPLNLQPGQTVELTFVSEEPRLVFALSKEANSGVPVRI
FT                   SDTGRWLNQLATSRNDAVQSTPLPRPSIILQEPPRDTGRLAEGLRNALTRSGVFYESHL
FT                   SQWVKGERPLADLLREPQGSLSRLAVATTSGGNNTSPAPANGGAPPQQNAAPPASQSPG
FT                   GPPAATTDAGQKPAAAPLPAANQPTGSQPAAGGGNAPSTVPASAGTGTTGSLGSPSVAT
FT                   PATGDAPQAPHQSGTPAPSVTTTPAGGAPPTDQAPPPLRPDGGTAALPDTDQATPRPQG
FT                   PAPDGTRPPTPQEPLRPDSTPVAGKPLPAPSQPDQSSPQGPTLRQVPLPDPAAQNSPTA
FT                   PGTTVVSQARGERIAVDQHAASQPRAPMALAADGDGVAVAARAGDPAATERAGGLRHIP
FT                   PPPQGGVEPQTIPIIKEQLTTLATGQFTWHGQVWPGQDMEWKVEEREADGRGSSAERSW
FT                   QTEVALDLPRLGSVRATLSLGSSGVTVNLAARNEETIAAMKEGRPRLEEALDAAGIRMT
FT                   GFRVSHDDE"
     atgatcgtga ctcaggaaat agcccggatc gcccaggccc tcctcaagga ttcgacgtac        60
     tcgctggtgg aggcccggtg gcagaccctg acgcccctca acctgacccc gggccagatg       120
     gtacaggcgg aggtgctggc caacctgccg gacagccgct acctgatccg gctggcaaac       180
     cagctcctgc gcatggagat ccccctcaac ctccagccgg ggcagaccgt ggagttgacc       240
     ttcgtctcgg aggagccgcg cctcgtcttc gccctgtcca aggaggcgaa ctcgggggta       300
     ccggtccgga tcagcgacac cggccgatgg ctcaatcagc tggccacgtc cagaaatgac       360
     gcggtccagt ccacgccgct cccccggccg tcgatcattc tacaggagcc gccacgggat       420
     acgggccgtc tggctgaagg gctgcgcaac gccctcaccc gtagcggcgt tttctatgag       480
     tcgcacctct cccagtgggt caagggggag cgccccttgg ccgatctcct ccgggagccc       540
     caggggtccc tctcacggct tgccgtggcc acgacttccg gcggcaacaa cacctcaccc       600
     gctccggcaa acggcggtgc gccaccccag cagaacgccg cgcccccggc ctcccagtcg       660
     ccgggaggac cacccgcggc cacaaccgat gcggggcaaa agcccgctgc tgccccgcta       720
     ccagcagcaa accagcccac gggcagtcaa ccggcggccg gcgggggaaa cgcaccctca       780
     accgtgcctg cctctgccgg cacgggcact accggcagcc tcggttcgcc gtcagtcgcc       840
     acgccagcca ccggagacgc accacaggcg ccgcaccagt ccggcacacc ggcaccctcc       900
     gtcaccacga caccagccgg tggtgccccc cccacggacc aggcgcctcc accgctgcgc       960
     cccgacggcg gcaccgcagc cctccctgat accgatcagg caaccccgcg accccaaggg      1020
     ccggcgccgg acgggacacg ccctccgaca ccccaggagc cccttcgtcc cgattcgacg      1080
     ccggtagccg gcaagccgct ccccgcacca tctcaaccgg accagtcatc accccagggg      1140
     ccgaccctcc ggcaagtgcc ccttcccgac cccgccgccc agaactcgcc gaccgcgccc      1200
     gggaccaccg tcgtttccca ggcgagaggc gagcgtatcg ccgttgacca gcacgcggca      1260
     tcccagcccc gtgcgcccat ggctctcgct gccgatggcg acggggttgc ggttgcggcc      1320
     cgtgccggag acccggcggc tacggaacgg gccgggggac tccgtcatat cccgccccct      1380
     ccccagggag gggtggagcc ccagactatc cctatcatca aggagcagct cacgacactg      1440
     gccacggggc agttcacctg gcacggacag gtctggcccg gccaggatat ggaatggaag      1500
     gtggaggagc gcgaggccga cggacggggc tcctcagcgg agcggagctg gcagacggaa      1560
     gtggcccttg acctgccccg actgggatcg gtccgggcga ccctgagcct cggcagttcc      1620
     ggggtaacgg tcaatctcgc ggcccggaac gaggaaacca tagcggccat gaaagaggga      1680
     aggccacgcc tcgaagaggc gctggacgca gccggcatcc gcatgaccgg tttcagggtg      1740
     agccatgacg acgaatga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page