(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE348

CP002031.PE348       Location/Qualifiers
FT   CDS_pept        381475..381879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83213"
FT                   /protein_id="ADI83213.1"
FT                   /translation="MELIVTFPGGKKVNAELGGMVIPTDQPVESGGEGTAPSPYDYFLA
FT                   SIGTCAGFYVLAFCQQRGIATENISLRQAMEFTPTADGRKKLSRVQMEIVVPSDFPEKY
FT                   RNALVKSAELCSVKRALADPPDFAIRTVVA"
     atggagctga tcgttacctt tcccggcggg aaaaaagtga acgccgaact gggcggcatg        60
     gtgatcccca cggaccagcc ggtggagtcg gggggtgagg gaacggcacc gtctccctat       120
     gattattttc tggcgtccat cggcacctgc gccggttttt acgttctcgc cttctgccag       180
     cagcgcggca tcgccacgga gaatatctcc ctgcgccagg ccatggagtt tacccccacg       240
     gcagacggca ggaagaaatt gtctcgggtc cagatggaga tcgtggtgcc gtccgatttc       300
     cccgaaaagt accgcaacgc cctggtcaag tccgcggagc tctgctcggt caagagggcg       360
     ctggcggacc cgcccgattt cgccatccga accgtggttg cgtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page