(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE361

CP002031.PE361       Location/Qualifiers
FT   CDS_pept        394117..394545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0363"
FT                   /product="redox-active protein, C_GCAxxG_C_C family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83226"
FT                   /protein_id="ADI83226.1"
FT                   /translation="MFWLKKKDNAPADSLAEQVGLDAEGFYRTGRMHCAEAVLMAMRNA
FT                   YSPEMPQDVVRVAAGFGGGSNAGCLCGAVSGGTMAFGLAVKEDKRRVNRLTRQLHDWFK
FT                   HEYGATCCRIATKNAKGKGGCAVLTGEVAKKAAELLEE"
     atgttctggt tgaagaaaaa ggataacgca ccggccgact cgcttgccga gcaggtcggg        60
     ctcgacgcgg agggattcta ccgcacgggc aggatgcact gcgccgaagc ggtgctcatg       120
     gcgatgcgca acgcctattc gccggaaatg ccccaggatg tggtccgggt ggcggccggc       180
     ttcggcggcg gctccaatgc cggttgtctg tgcggagcgg tttccggggg aaccatggcc       240
     ttcgggctgg cggtgaagga ggacaagcga cgggtgaacc gtctcacccg ccaactccat       300
     gactggttca agcacgaata cggcgcaacc tgctgccgca tcgccaccaa aaacgccaag       360
     ggaaagggcg gctgcgcggt ccttaccggc gaagtggcca aaaaggcggc ggaattactg       420
     gaagagtaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page