(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE364

CP002031.PE364       Location/Qualifiers
FT   CDS_pept        395619..395999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0366"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83229"
FT                   /protein_id="ADI83229.1"
FT                   /translation="MIRKFIIAVFMVTSLAATALAAPYRNIGSAEAKALLDKKRNVFLL
FT                   DVRTPDEYRQARLAGSVLIPINEVERRIAQIPKGRPVLVYCAVGSRSGLVAGYLTQRGY
FT                   GEVYNMHDGIVGWYRNGFPITR"
     atgatcagga agtttatcat tgccgtgttc atggtgacgt cgctcgccgc caccgccctg        60
     gctgcgccct accgcaacat cggttcggcc gaggccaagg cgctgcttga caagaaacgc       120
     aacgtctttc tcctggacgt gcggacccct gacgaatacc gccaggcccg cttggccggg       180
     tcggtgctta ttccaatcaa cgaagtggag cgccgcatcg cacagatccc caaggggagg       240
     ccggtgctgg tctattgcgc cgtgggctcc cgctcggggc tcgtggccgg ctacctgacc       300
     cagcggggat acggcgaagt ctacaacatg cacgacggca tcgtcggctg gtatcgcaac       360
     gggtttccga tcacccggtg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page