(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE368

CP002031.PE368       Location/Qualifiers
FT   CDS_pept        400154..400561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0370"
FT                   /product="hemerythrin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83233"
FT                   /protein_id="ADI83233.1"
FT                   /translation="MALISWSDSLSVKVKQFDDQHKKLVDMVNQLFDAMKAGKGNQVMG
FT                   DILKSLIQYTQTHFAAEERIMKQYGYPDFEAHKKEHNALVMQVLDLQKQFQEGKAVLTQ
FT                   NVMTFLRDWLSKHIQGDDKKYGVYLNGKGVS"
     atggcattga tctcgtggag tgactcgctc agcgtcaagg tgaagcagtt cgacgaccag        60
     cacaaaaagc tggtggacat ggtgaaccag ttgttcgacg ccatgaaggc cggcaagggg       120
     aaccaggtga tgggggacat cctgaagtct ctcatccagt acactcagac ccacttcgcc       180
     gcggaagagc ggattatgaa gcagtacggc taccctgact tcgaagccca caaaaaggag       240
     cataacgctc tagtcatgca ggtgctcgat ctgcagaagc agttccagga aggcaaggcg       300
     gtgctgactc agaacgtcat gaccttcctg cgcgactggc tttccaagca tatccaggga       360
     gacgacaaga aatacggcgt gtacctgaac ggcaaagggg tttcctag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page