(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE372

CP002031.PE372       Location/Qualifiers
FT   CDS_pept        402925..405015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83237"
FT                   /protein_id="ADI83237.2"
FT                   /translation="MIRFIVKLLLCALVLLPLPAFATSGADTGPDNRLLRMGVRAHGGF
FT                   TRLSMAFERDIAPVLHQLSGNRVRLVFSNTVGGRWKKLRSYRDAHVEGVVVAPRGNDLM
FT                   VTVTIKGDPRGVRVSTSPGAGVVSLDVGASLAPRRSPPLAQGREGIKVGVEQLITTFDP
FT                   PFKSEIPFTPTDRRVLEAMVPPAEAALIMDGEAALYEGNGSEAAEIFAGIGTNSPGRPL
FT                   ALYRLGEANYLLQKYGDALRFFREAERQWPVFLTRSPSTAFCYADSVARSGDLAGGRRL
FT                   LGSLIAGLADKKYAPALLVRMADILARQGKDQEALAIYRNVADNFTGSKGSWQARMKLA
FT                   DRRLLALEPAAYSSLVKDYLEIYERGTDFGLREQGLFKAALLLSLYGDADQAFARVAEY
FT                   EKKFPRGMYVSIAKGMREELLVPVYRRITRAGDNEALVKLALENRDYLGRVLAEDDFIK
FT                   NLSAAFADLGRIKEEVGLYANLAIREQNRVYAPELYRRILHDAEQLGDPTLMEKAAGEF
FT                   VERFPAHPWVQRFREELAAVEYNRGDFQRVVGRLSGMLASGTRPEYAESLYYLGKSLDA
FT                   SGNRRDAERAMLLFLAELRRREMSSPLAADASYVAATARLSRGDRKGAKEILRAAGEAS
FT                   PEERDPFLYKLGEIARSEGRYEEAAHYLRTVVKEGKDPDWRDMASRLLADMELTGMVRK
FT                   SK"
     atgattcgtt tcatcgtcaa gctgctgctc tgtgcactgg tcctgctgcc gctgcccgcg        60
     tttgccacgt ccggcgccga taccggcccg gacaaccgtc tgctgcgtat gggggtgcgc       120
     gcccacgggg gatttacccg gctttccatg gcgttcgagc gcgacattgc ccctgtcctg       180
     caccagctct cgggcaacag ggttcggctg gttttcagca acacggtcgg cggccgctgg       240
     aagaagctgc ggagctaccg cgacgcgcat gtggaggggg tagtcgtggc gccgcgcggt       300
     aatgacctta tggtaacggt aacgatcaag ggggaccctc ggggcgtacg cgtctcaacc       360
     tcgcccggcg ctggcgttgt ttctctcgat gtgggagcgt cgctcgcccc ccgccgctcg       420
     cctcctcttg cccaggggcg tgaggggatc aaggtcgggg tcgagcagct catcaccacg       480
     ttcgatccgc cgtttaagtc tgagatcccc tttaccccca ctgaccggcg ggtgctcgaa       540
     gcaatggtcc ctcccgccga ggccgctctg atcatggacg gcgaggctgc cctctatgaa       600
     ggcaacggca gcgaggccgc cgagatcttc gccgggatag gcaccaactc tcccggccgc       660
     cccctggccc tttaccggct gggggaggcc aactaccttc tccagaagta cggggatgct       720
     cttcgctttt tccgcgaggc ggagcgccag tggcccgtct tcctcacccg gtcgccgtcc       780
     acggccttct gctatgccga cagcgtggcc cgtagcggtg atctggcggg cggtcgccgg       840
     ctgctcggat cgctcatcgc cggcttggcc gataaaaagt acgcgccggc gctcctggtg       900
     cgcatggccg atatcctggc gcgacagggg aaggaccaag aggcgctggc catctaccgc       960
     aacgttgccg acaattttac cggcagcaaa gggagctggc aggcccggat gaagctcgcc      1020
     gaccgccggc tgcttgcctt ggagcccgca gcttacagtt cgctggtgaa ggattacctg      1080
     gagatctatg agcggggtac ggatttcggc ctgcgcgagc agggattatt caaggcggct      1140
     ctgctgctct ccctgtatgg tgatgccgat caggcctttg cccgggtggc tgaatacgag      1200
     aaaaaatttc cgcgcgggat gtatgtcagc attgccaagg ggatgcgtga ggaactcctg      1260
     gtaccggtct accgccggat cacccgcgcc ggtgacaacg aagcccttgt gaagctcgcc      1320
     ctggagaacc gggactatct cggccgcgtc ctggccgagg acgacttcat caaaaacctg      1380
     tccgccgctt tcgccgatct gggaaggatc aaggaggagg tcggcctgta cgcgaatctc      1440
     gccatccgcg agcaaaaccg ggtgtacgcc cccgagctct atcgcaggat tctccacgat      1500
     gccgagcagc tgggagaccc gaccctcatg gagaaggccg cgggtgaatt tgtggagcgg      1560
     ttcccggccc atccctgggt acagcggttc cgtgaggagc ttgctgcggt cgagtataac      1620
     cggggagact tccagcgggt ggtgggccgg ctgtcgggga tgctggcgtc gggaacacgg      1680
     cccgagtatg ccgagagcct gtactatctg ggcaagtctc tggacgcctc cggcaaccgg      1740
     cgcgatgccg agcgggccat gctcctcttt ctggccgagc tccggcgccg cgaaatgtct      1800
     tcgccgctgg ccgccgatgc aagctacgtg gctgcaaccg ctcgactgtc gcggggtgac      1860
     cgtaagggag ccaaggaaat actgcgggcc gccggtgagg cttctcccga agagcgggat      1920
     ccattcctct acaaactggg cgagatcgcc cgctccgaag ggcgttacga ggaggctgcc      1980
     cactatctca ggacagtggt caaggaggga aaagaccctg attggcggga tatggcatcg      2040
     cgcctccttg ccgatatgga gttgacggga atggtccgca agtcaaaatg a               2091
//

If you have problems or comments...

PBIL Back to PBIL home page