(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE405

CP002031.PE405       Location/Qualifiers
FT   CDS_pept        complement(435308..435859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83270"
FT                   /protein_id="ADI83270.1"
FT                   /translation="MVVSRKTESYQPGMTVRHERLGLGKVVAVEGSGIVSVRFDSWGTK
FT                   HFDPLSEPMAPLTENELREQLEVAVSRWEEAIPWLEQGWDCIEEYTNDLTAREILDDAI
FT                   DGYCGMPLPHDLAERIERADARFRAATEESELCVWHPEKPYPYGESAPYAPDRQWYYFR
FT                   WPPDAPYRFRKHDSTAARNE"
     atggtggttt cgcgaaaaac ggagagctat caaccgggaa tgacggttcg gcatgaacgg        60
     ctcggcctgg ggaaagtggt cgccgtggag ggttccggaa tcgtcagtgt acggtttgac       120
     tcttggggca ccaagcattt tgaccccctg tccgaaccaa tggcgccgct gacggagaat       180
     gagctgagag aacagctcga agttgcggtt tcccgatggg aagaggcgat cccctggctg       240
     gagcagggat gggattgcat agaggaatat accaatgacc ttacggcacg ggagatcctc       300
     gacgatgcca ttgacgggta ctgcggcatg ccgctgcccc acgatctcgc ggagcggatc       360
     gaacgggccg acgcccgttt ccgggccgcc accgaggaat cggaactctg tgtctggcac       420
     cccgaaaagc cgtatcccta cggcgagtct gcgccctatg ccccagaccg gcagtggtat       480
     tatttccgct ggccccctga cgcaccctac aggttccgga agcacgacag cacggcagcc       540
     cgaaacgaat ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page