(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE415

CP002031.PE415       Location/Qualifiers
FT   CDS_pept        complement(446433..447158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83282"
FT                   /protein_id="ADI83282.1"
FT                   /translation="MKCPKCGYNSFEFLDNCKKCSHDLSAFKQTHGIRAVVLPLAGLTV
FT                   AAPAVAVAAPSAANAANAEESFTWEVPAAPESFKPGDDIFSDLDLGLSPSPAPAEPASA
FT                   GLDLGDFSFDDTPAAPAVPAPSTTDADAGTDDFATLLETGDNSEITAAAPGAAQVPEME
FT                   SPWEVPTDSFGGFGDTPAPAAEPAASGDFDLESFSWDDKETKTETPPAAPKGPEAGVES
FT                   FPGTDFDSLFGDAGEDEKK"
     atgaaatgtc ccaagtgcgg ctacaacagc ttcgaattcc tcgataactg caagaagtgc        60
     agccacgatc tctccgcctt caagcagacc cacggtatcc gggccgtggt gctccccttg       120
     gcgggactga ccgtagcggc accggccgtc gccgttgcgg cgccgtcggc agcaaacgct       180
     gcgaatgccg aagaaagctt cacctgggaa gtccctgcgg cgccggagtc tttcaagccg       240
     ggggacgaca tcttctccga cctggacctg gggctctcac cgtcaccggc gccggctgag       300
     ccggcatccg ccgggcttga cctgggcgac ttttccttcg acgacacccc tgcggcaccc       360
     gccgtacccg ctccctcaac cactgatgcc gacgccggca ccgatgattt cgcgacgctc       420
     ctggaaaccg gcgacaacag tgagataacg gctgccgcgc ccggcgccgc gcaggtgccg       480
     gagatggaaa gcccctggga ggtgccgact gacagcttcg gcgggttcgg agatacgccc       540
     gcgcccgcgg cagaaccggc tgcatccggc gactttgacc tggaaagctt cagttgggac       600
     gataaggaga cgaaaacgga gacgccgccc gccgccccca aggggccgga ggcgggagtt       660
     gaaagttttc cggggaccga ttttgactcc ctcttcggcg atgccggaga ggatgagaag       720
     aagtag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page