(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE424

CP002031.PE424       Location/Qualifiers
FT   CDS_pept        454947..455399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0428"
FT                   /product="rare lipoprotein A-like double-psi beta-barrel
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83291"
FT                   /protein_id="ADI83291.1"
FT                   /translation="MVSALRKGRLAILIILCQAFFQIQTLSLQAEEIAAKETSDKEAAI
FT                   AAAADEGVTGTASYYAKRYHGRRTTSGKRYDPKKLTAAHPTLPLGTKVKVVNLTNDREV
FT                   TVTITDRCRKRVNHFIDLSREAARRLGFLGKGVTQVRIITLDETAS"
     atggtatctg cactccggaa agggcgtctg gccatcttga tcattctctg ccaggcgttc        60
     ttccagatcc agacactgtc cttgcaagca gaggaaattg cagcaaagga aacatccgac       120
     aaagaggccg caattgcggc cgcggccgac gaaggggtca cggggaccgc ttcgtactac       180
     gccaagcgct atcacggaag aagaacgaca tcggggaagc ggtacgatcc gaagaagctt       240
     accgccgcac accccaccct ccctctcggt accaaggtca aggtggttaa cctgaccaac       300
     gaccgtgagg tgacggtcac cataaccgat cgctgccgga agagggtgaa ccatttcatc       360
     gacctctccc gggaagcggc caggaggctt ggattcctcg gcaaaggggt gacgcaggtg       420
     cgaatcatca ccctcgacga aaccgcatcc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page