(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE429

CP002031.PE429       Location/Qualifiers
FT   CDS_pept        complement(459709..460734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0433"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83296"
FT                   /protein_id="ADI83296.1"
FT                   /translation="MDIAVTGLAAISAAGVGIEPLRETVAQRQCRLTPVPVEVLGEDGY
FT                   LWGKADGFRAADFMPPLKARKFDRCSLLATVAAGMALADAGIDPKGGDPTRIGIALGCG
FT                   FGGIANSVEFLGGYFSRGVEGLVPMLFPNTVANAAASNASIEHGLKGPNVTQVQRFCSA
FT                   EAAIQMACRFLEEGRADVMLAGGVDELTPLMMAGFQAVGQLRTYARSFSEGCGILVLER
FT                   RDHAERRAARLRGRITGLRTVGMLPAGREQETVDRLMPPAAPALVSLSGIAADITALIA
FT                   PLPAVPTLESGNLIGRSLAMGGLALASLLLVLPEGARGLHLAASPEGPYHAIDVTGGMR
FT                   A"
     atggacatag ccgtcaccgg cctcgccgcc atctccgccg ccggggtggg aatcgaaccg        60
     ttgcgggaaa cggtggcaca gcgtcaatgc cgcctcaccc ccgtccccgt tgaagtcctc       120
     ggtgaagacg gatatctctg gggcaaggcg gatggcttca gggccgccga tttcatgcct       180
     cccctcaagg cccgaaagtt cgaccggtgc agccttctgg ccactgtggc cgcaggcatg       240
     gccctggccg atgccggcat cgacccgaag gggggcgatc ccacacgcat cggcatcgcc       300
     ctgggctgcg gcttcggcgg catcgccaat tccgtggagt ttctgggcgg ctacttctcc       360
     aggggcgtgg aagggctcgt gcccatgctc ttccccaata ccgttgccaa tgccgccgcc       420
     agcaacgcct ccatcgagca tggcctcaag gggcccaacg tgacccaagt acagcgcttc       480
     tgctccgcag aggctgctat ccagatggcc tgtcgtttcc tggaggaagg gcgggccgac       540
     gtgatgctgg cgggcggagt ggatgagctg accccgctga tgatggccgg cttccaggcc       600
     gtgggccagt tgcggaccta tgcccgctcc ttcagcgagg ggtgcggcat cctggtcctt       660
     gagcggcgag accatgcgga acgacgcgcc gccaggctgc ggggccgaat cacgggactg       720
     cgaacggtgg gcatgctgcc cgccggccgg gaacaggaga cggtcgaccg actcatgcca       780
     cccgcggcac cggccctggt gtcgctctcg ggaatcgcag ccgacatcac agccctcatc       840
     gctccactcc ctgccgtgcc gactttggaa tcgggcaacc ttatcggacg atccctggcc       900
     atgggggggc ttgccctggc ctcgctcctg ctggtcctcc ccgaaggtgc ccgggggctc       960
     cacctggcag cgtcgcccga aggaccgtac cacgccatcg acgtcaccgg gggtatgcgt      1020
     gcatag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page