(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE433

CP002031.PE433       Location/Qualifiers
FT   CDS_pept        complement(463945..465186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0437"
FT                   /product="membrane protein of unknown function DUF898"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83300"
FT                   /protein_id="ADI83300.1"
FT                   /translation="MDRETVSCPACGFSRDMPAGTIPDGAQVTCPRCRDTFMFARGAAA
FT                   EADPVPTIASPQGPEAAVAAPAAPPTACPRTLRFSFTGAAREYFGIWIVNTLLKILTLG
FT                   VYSAWAKVRKRRYLYGNTMLHGAPFDYLANPRVLFRGWLIGVLAFLLYTLGTNYSPTLS
FT                   FVIGALFFAAVPWLVVRSRLFNLRNTSYRNLRFTFRADYCQAYLVYGLLSLLVPLTLGL
FT                   LYPYAAYRRKRFLVENSAYGTTSFSFTATTRDFYLLYLKAVAGFVAIVIVAVPFLFLAG
FT                   GAFLPAGTGGPWRLAAVLPAFLIPLAYLYFVIYISTNETNLVWSGTQVAGARFTCSLRA
FT                   RHMAWLYLSNAVAIFLTLGLMIPWATVRVLRYRMENLTVLATGDLEEFAAAPTEEVTAT
FT                   GEEIGDIFGIDVAL"
     gtggaccgtg aaaccgtaag ctgccccgcc tgtgggttca gcagggacat gccggccggg        60
     accattcccg acggcgccca ggtcacctgt ccccggtgca gggatacgtt catgttcgcc       120
     cgaggcgctg ctgccgaagc cgacccggtt ccgacgatcg cgtctccgca gggtccggaa       180
     gcagccgttg ccgcccccgc agccccgcca acggcctgcc cccggaccct tcgcttcagc       240
     ttcaccggcg cggccaggga atacttcggc atctggatcg tcaacaccct tctcaagatc       300
     ctcaccctgg gggtctattc ggcctgggcc aaggtccgca agcgccgcta cctctacggc       360
     aacaccatgc tccacggtgc gcccttcgac tacctggcca atccccgagt cctgttccgg       420
     ggctggctca tcggggtgct ggcctttctg ctctataccc tcgggaccaa ttacagcccc       480
     accctctcct tcgtcatcgg cgccctgttc ttcgcggccg tgccgtggct cgtggtccgc       540
     tcgcgcctct tcaacctccg caacacgagt tatcgtaacc tgcgcttcac cttccgggcc       600
     gactactgcc aggcctacct ggtctacggg ctcctctccc tgctggtgcc gctgacgctg       660
     ggactcctct acccctatgc ggcctaccgg cgaaaacgat tcctcgtgga aaactccgcc       720
     tacggtacga cttcattttc cttcaccgcc acgaccaggg atttttacct cctctacctc       780
     aaggccgtgg caggctttgt tgcgatcgtg atagttgcgg tcccgtttct gttcctggcc       840
     ggaggggcgt tcctgcctgc gggtacggga ggcccctggc gactggcagc cgtgctgccg       900
     gcgttcctca ttcccctggc ctacctttat ttcgtcatct atatcagcac caacgagacg       960
     aacctcgtct ggagcggcac gcaggtagca ggcgcccgtt tcacctgctc gctccgggcc      1020
     cgtcacatgg catggctcta tctctccaat gccgtggcca tcttcctgac cctggggctc      1080
     atgatcccgt gggccacggt gagggtcctc cgctaccgga tggagaacct gaccgtcctt      1140
     gccaccggag acctggagga gtttgccgcg gcaccgaccg aggaggttac ggccaccggc      1200
     gaggagatcg gcgacatctt cggcatcgat gtggccctat ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page