(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE438

CP002031.PE438       Location/Qualifiers
FT   CDS_pept        468808..469119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0442"
FT                   /product="phage regulatory protein, AlpA family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83305"
FT                   /protein_id="ADI83305.1"
FT                   /translation="MGNIIVPKITLPETGFVRLPNIIGDPKADPPIAPIIPVSKSTWWA
FT                   GVKSGRYPQPIKLGPRITAWRVEDIRELVREARTFQGGMDNGQNWMAGGADGLGKDHV"
     atgggaaaca tcatcgtacc caaaatcacc ctgccggaaa ccggttttgt ccggcttccc        60
     aacataatcg gcgatcccaa ggccgatccc cccatcgcgc ccatcattcc tgtgtccaag       120
     agcacctggt gggctggggt taagtcaggc cgatatcctc aaccgataaa actcggtccc       180
     cgcataacag cctggcgggt ggaggatatt cgggaactcg ttcgcgaggc ccggacgttt       240
     cagggcggca tggacaatgg acagaattgg atggcagggg gtgccgatgg actgggtaaa       300
     gatcatgtgt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page