(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE441

CP002031.PE441       Location/Qualifiers
FT   CDS_pept        join(470662..471144,471146..471559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83308"
FT                   /protein_id="ADI83308.2"
FT                   /translation="MPSFRSAKTQAEHAVSRKIALGQGRHDHRDDGKIHSVGTARGYEQ
FT                   ALKGATEYVQEHRLGDLRSLTVEIAQQYLADRAAIVSQKTLDIDRQAMQMHLGVRLEVV
FT                   KSELETHLTTRSYTATQVERIASAQSERNSLATQIAHNAGLRAHELLTIRLANERPPPP
FT                   PTHREWSAERFAGREGERYTVEGKGGLVREVLLSRELAAQLEATRLGEPRQVTDRGVNY
FT                   TQHYNIGGGRAWSQSFSAASQRELGFSNGAHGLRHSYAQERMEEMQRGGMNYDDAKGTV
FT                   AQEVGHFDKETTEAYLR"
FT                   /artificial_location="low-quality sequence region"
     atgccgagct tcagatccgc aaagacgcag gccgagcatg ccgtctcccg gaagatcgcc        60
     ttgggccaag ggagacacga ccaccgggac gacggcaaga tccacagtgt cggaacggca       120
     cggggatatg agcaggccct caagggagct accgaatacg tccaggagca ccggctgggc       180
     gaccttcgca gtctgaccgt cgagatcgcc cagcagtacc tcgccgaccg ggccgcgatc       240
     gtctcccaaa agaccctcga catcgaccgc caggcgatgc agatgcatct gggggtgcgg       300
     cttgaagtgg tgaagagcga gctggagact cacctcacca ccaggagcta tacagcaact       360
     caggtggaac ggatcgcctc cgctcagtcg gaacggaaca gtctggccac gcagattgcc       420
     cacaatgcgg ggctccgggc gcacgagctg ttaacgatcc ggctggcgaa cgagcggccg       480
     cccccacccc ccactcaccg agagtggagc gcggagcgct tcgccggccg ggagggtgag       540
     cggtacacgg tggaagggaa agggggcctg gtgcgggagg tcctgctgtc gagggagttg       600
     gcggcgcagc tggaggcgac acgccttggc gagccgcgcc aggtgactga ccggggggtg       660
     aactacaccc agcactacaa catcggtggt ggccgggcgt ggagtcagag cttttcggcg       720
     gcgagccagc gggagcttgg cttttccaac ggggcgcacg gcctgcgcca cagctacgcc       780
     caggagcgga tggaagagat gcagcgcggc ggcatgaact acgatgacgc caagggaacg       840
     gtcgcccagg aggttgggca tttcgacaag gaaaccacgg aggcatattt acgatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page