(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE445

CP002031.PE445       Location/Qualifiers
FT   CDS_pept        complement(478024..478608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0450"
FT                   /product="7-cyano-7-deazaguanine synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83313"
FT                   /protein_id="ADI83313.2"
FT                   /translation="MGLVNLVSGGLDSTLVGVLAREDGLSVYPLFINYGQKAVQQEWEA
FT                   CQRVHQALNLPTPIKMDLSGFGKVICSGLTNDKMDVKEEAFTPGRNLLFLLMGSAYAYQ
FT                   VGASAVAIGLLTEQFSLFPDQRTLFLEKAEQAIEAALGKNIKLLAPLSDFSKMDVVKLS
FT                   IEKGIAGTYSCHAGGDQPCGHCISCLEFELR"
     atgggtttag tcaatcttgt ttccggtggc ctggactcaa cccttgtagg cgttttggcc        60
     agagaagatg gcctctcagt ttaccctctt tttatcaatt acggtcagaa agccgtccaa       120
     caggaatggg aggcatgtca gcgggtgcat caggctctaa acctccctac tccaatcaag       180
     atggacctgt ccgggtttgg aaaggtcatt tgttctggtt tgacaaatga caagatggac       240
     gtaaaggaag aagctttcac cccaggaaga aatttgctgt ttctcctgat gggaagcgcc       300
     tacgcttatc aagtgggggc ctcggcggta gctatcgggc tgctgaccga acaattcagc       360
     ttgtttcccg atcaacggac cttgttcctg gaaaaggctg aacaggctat tgaggcagct       420
     cttgggaaga atatcaagct gctggccccg ctctcagatt tcagcaaaat ggatgtcgtc       480
     aaactttcca tcgagaaagg tatcgccggc acgtattcat gccatgctgg tggagaccaa       540
     ccttgcggac attgtatttc ttgtctcgaa tttgaactca gataa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page