(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE450

CP002031.PE450       Location/Qualifiers
FT   CDS_pept        complement(486144..486497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83318"
FT                   /protein_id="ADI83318.1"
FT                   /translation="MTRKVLAVAVMVAAGALALGGEAMARGGKGPMAGQGTGDRLQLRD
FT                   GSCLSSTATATAASAATSSRQQLRDGSGAGTARQGVGTGAMRRLGPGDGTGNVTPPQDG
FT                   TGYGSAYTGGTAR"
     atgaccagaa aagttcttgc agtagcagtg atggtggcag ccggcgccct tgccctcggc        60
     ggcgaggcca tggctcgggg cggtaagggc cccatggccg gccaggggac cggagaccgg       120
     ctccagctcc gcgacggaag ctgcctctcc agtacggcaa cggcaacggc ggcgtcagct       180
     gcgacctcgt cccgccagca actccgtgat ggcagcggag ccggcaccgc ccgtcagggc       240
     gtcgggacgg gagccatgag gcgcctcggc cccggcgacg gcaccggcaa cgtaactcct       300
     ccccaggacg gcaccggcta cggctccgcc tataccggcg gaaccgcccg gtag             354
//

If you have problems or comments...

PBIL Back to PBIL home page