(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE453

CP002031.PE453       Location/Qualifiers
FT   CDS_pept        489455..489925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0458"
FT                   /product="SRPBCC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83321"
FT                   /protein_id="ADI83321.1"
FT                   /translation="MKMYQLSRTQILPVPLTVAWDFFSDPRNLAAITPPDMGFVITSPV
FT                   PERTHAGMVVTYAVSPFGGLRLPWVTEITHCAEPSLFVDEQRFGPYRFWHHQHHFLEVS
FT                   GGVEMRDIVHYILPFGIIGRLSAPVVAKRLKAIFDYRRDTLAVRFAALSRGA"
     atgaaaatgt atcaattgtc cagaacgcag atcctgcccg tgccgttgac ggtagcctgg        60
     gactttttct cggatccgcg caatcttgcc gccattaccc cgccggatat ggggttcgtc       120
     attacctcgc cggtgccgga gcggacccat gcggggatgg tggtaaccta tgcggtctca       180
     ccattcggtg gccttcggtt gccgtgggtt accgagatca cccattgcgc ggagccctct       240
     cttttcgtgg acgagcagcg tttcgggcca taccgtttct ggcaccacca gcaccacttt       300
     ctggaagtgt ccggcggggt agaaatgcga gatatcgtcc actacatact ccccttcggc       360
     atcatcggac gtctttccgc gcccgttgtg gcgaagcggc ttaaggcgat cttcgactac       420
     cggcgcgata cgctcgctgt ccgcttcgcc gctctttcac ggggcgcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page