(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE455

CP002031.PE455       Location/Qualifiers
FT   CDS_pept        491196..493574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0460"
FT                   /product="sensor diguanylate cyclase/phosphodiesterase, PAS
FT                   and PAS domain-containing"
FT                   /note="domains: PAS, PAS, GGDEF, EAL"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83323"
FT                   /protein_id="ADI83323.1"
FT                   /translation="MDFTKISALHYRLPSPVRQFIVLLSIIFLIEMLLMAVLPQVTGRE
FT                   VEFKDALVDSMGLVTVAAPFLWAFIVRPLRRTAVAAVFREEVLLRQMVDGVITFGEDGT
FT                   IRSLNPAAERMFGYRDDEAAGMAIDCLLSADGGYFRFAVQASGGHGTRQLAYELEGIRR
FT                   DGSRFVADLSVSRIVFEDHRAVIGIVRDITARKRDEQNLLVFKRAIESSVNGITITDAT
FT                   NGENLIIYVNPAFERMTGYAGHEVLGKNPRFLRGDDRDQVELRKLAMALEERREGYFVL
FT                   RNYRKDGSQFMNELYVAPVRDRDGAVTNYIGIMNDISDQRRYEEQLVYQATHDPLTGLP
FT                   NRNLLQDRLGQALALESFRRRNPIGVMFLDLDNFKKINDTLGHTVGDMLLKAVANRLRN
FT                   CVRGGDTVSRLGGDEYILILPNVKEMHDVTTVAKKLLGVFSTPFLLMGHELYITASIGI
FT                   TLFPSDGDTVDALLKNADAAMYHAKEQGKNNYQFYSEEMNTRVFERMALETSLHRAIRQ
FT                   HEFLLCYQPRVDLRTGRISGVEALVRWNHPEMGLVPPARFIPLAEETGLIVPIGEWVLR
FT                   TACAQNKAWQDAGLPPLRMAVNLSARQFRQENLIQMVADALAETGLDPRWLELELTESL
FT                   LMEQAEQSVSILRSLADMGIDIAVDDFGTGYSSLGYLKRFPITNLKIDQSFIRDIASDP
FT                   DDAILVRTIITMAHGLGMKTVGEGVESLEQIDFLYRHGCEEVQGYYFSRPLTAEGCEEL
FT                   LREERFLDLRALRDGLPGQRSEERIRALASSADDCRVTA"
     atggatttca caaaaatctc cgcactccac taccgccttc cttcaccggt gcggcagttc        60
     atcgtgctgc tttcgatcat ttttctgatc gaaatgctgc tcatggcggt cctgccccaa       120
     gttaccggcc gtgaagtcga gtttaaggat gcacttgtcg acagcatggg gctcgtcacg       180
     gttgccgcgc cgtttctgtg ggctttcatt gtgcgtcccc tgcgccgcac ggccgttgcg       240
     gccgttttcc gggaggaggt actcctccgc cagatggtcg acggggtgat tactttcggg       300
     gaagacggca cgatccgttc cctcaatccg gccgccgagc ggatgttcgg ctatcgggac       360
     gatgaggccg ccggcatggc catcgactgc ctgctgtcgg ccgacggggg ctatttccga       420
     tttgcggtac aggcatccgg cggccatggc acacgccagc tcgcctatga actggaaggg       480
     atccgccggg atggcagccg cttcgttgcc gatctttccg tcagccggat cgtttttgaa       540
     gatcaccggg cagtgatcgg cattgtccgg gacatcaccg cccgcaaacg ggacgagcag       600
     aatctcctcg tcttcaaacg ggccatcgag tcgagcgtaa acggcatcac tatcaccgac       660
     gcgactaacg gcgaaaacct aatcatttac gtgaatcctg cattcgagcg gatgaccggc       720
     tacgcgggac acgaggttct tgggaagaac ccgcgttttc tcagggggga tgaccgggac       780
     caggtggaac tcaggaagct ggccatggcc ctggaggaac gcagggaggg ctactttgtc       840
     ctgcgcaact accgcaagga cggcagccag ttcatgaacg aactttacgt ggcgccggtg       900
     cgcgaccgtg atggcgcagt caccaattac atcggcatca tgaatgatat cagcgaccag       960
     cggcgctacg aggaacagct ggtctaccag gccactcacg accccctgac cggccttccc      1020
     aaccgtaatc tcctgcagga ccgccttggg caggcgctcg ctctggaatc cttccgccgt      1080
     cgcaatccca tcggcgtcat gttcctggat ctcgacaact tcaaaaagat caacgatacc      1140
     ctggggcaca cggtgggaga catgctgctc aaggccgtcg ccaaccgcct gcgcaactgc      1200
     gtgcgcggcg gcgacacggt ttcgcggctg ggaggggacg aatacatcct tatccttccc      1260
     aatgtaaagg aaatgcatga cgtgaccact gtggccaaga agctgctcgg cgtattttcc      1320
     acgccgttcc tgctcatggg acacgagctc tacatcacgg caagcatcgg tatcaccctc      1380
     ttcccctccg atggcgacac ggtggatgcg ctcctcaaga atgccgatgc cgccatgtat      1440
     catgccaagg agcaggggaa gaacaactac cagttctatt cagaggagat gaacacgcgg      1500
     gtcttcgagc ggatggctct ggaaacgagc ctccatcggg cgattcggca gcatgagttt      1560
     ctgctctgct accagcctcg ggtcgatctg cggaccggaa ggatcagcgg ggtggaagcc      1620
     cttgtgcgtt ggaaccaccc ggagatgggg ctcgtgccgc cggccaggtt catccctctg      1680
     gccgaggaaa cggggctcat cgtgcccatc ggcgagtggg tcctgcgcac cgcctgcgcc      1740
     cagaacaagg catggcagga tgcggggctc ccgccactga ggatggcggt gaacctttcg      1800
     gcccggcagt tccgtcagga aaatctcatc cagatggtcg ccgacgcctt ggccgaaacg      1860
     ggtctcgacc cccgctggct ggagctggag ctgaccgaaa gcctcctcat ggagcaggcc      1920
     gagcagtccg tgtcgatcct ccgctccctg gcggatatgg ggatcgacat cgccgtggac      1980
     gatttcggca ccggctattc gtctctgggg tatctcaagc ggttcccgat tacgaacctg      2040
     aagatcgatc aatcgttcat ccgcgacata gcgagcgatc cggacgacgc cattctggtg      2100
     cggaccatca tcaccatggc ccacggcctc ggcatgaaga ccgtcggcga aggggtcgaa      2160
     tctcttgagc agattgattt cctctatcgg cacggctgcg aagaagtgca gggatactat      2220
     ttcagcaggc cgcttaccgc tgagggatgc gaggagctgc ttcgcgagga gaggtttctg      2280
     gatcttcggg cgctccggga tgggttgccg ggccagagga gcgaggagcg cattcgcgcc      2340
     ctggcgtcat ccgctgatga ctgccgcgtt acagcgtaa                             2379
//

If you have problems or comments...

PBIL Back to PBIL home page