(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE461

CP002031.PE461       Location/Qualifiers
FT   CDS_pept        499555..499779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0467"
FT                   /product="thioredoxin/NifU-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83330"
FT                   /protein_id="ADI83330.1"
FT                   /translation="MLEDVKKVLDLVRPALQADGGDVELVEVTEDGVVKVKLVGACGHC
FT                   PMSTMTLKMGIERTLKEKVPGVKEVVSVQ"
     atgctggaag acgttaagaa ggttcttgat ctggtccgcc ccgcgctcca ggcggatggc        60
     ggtgacgtgg agctggttga ggttaccgag gacggcgtgg tgaaggttaa gctggtcggt       120
     gcctgcggcc actgccccat gtccaccatg accctcaaga tggggatcga gcggaccctg       180
     aaggagaagg tgccgggagt gaaggaagtg gtatccgtcc agtag                       225
//

If you have problems or comments...

PBIL Back to PBIL home page