(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE462

CP002031.PE462       Location/Qualifiers
FT   CDS_pept        499816..500016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83331"
FT                   /protein_id="ADI83331.1"
FT                   /translation="MGYKVKTFGMELRPLKAMQELFALDAMVNAFVAENGVKRIVSVSD
FT                   SPTTDDKGETIGLVRVVAYED"
     atgggttaca aggtcaaaac gtttggcatg gagctccgtc ccctcaaggc catgcaggag        60
     cttttcgccc tggatgccat ggtcaacgca ttcgtagctg aaaatggcgt gaagcggatc       120
     gtttccgtct ccgactcgcc gaccaccgat gacaagggcg aaacaatcgg cctcgtcagg       180
     gtggtcgcct acgaggactg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page