(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE466

CP002031.PE466       Location/Qualifiers
FT   CDS_pept        503101..503838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0472"
FT                   /product="protein of unknown function DUF2064"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83335"
FT                   /protein_id="ADI83335.2"
FT                   /translation="MSAVNPLPMSLQPCRKALMIFAKRPMAGRVKTRLTPPLSPGDAAE
FT                   LYRRMLLDILAKCARMVGVDLLLFYEPGEGSGRFFEEAAPGWACRPQEGGDLGARLDSA
FT                   FRLAFGEGYGEVAVIGTDSPDLPEEYVRLAFDLLDHRAVDAVYGPSEDGGYYLLALKQH
FT                   RPELFRDIPWSTGEVLEHSLARAKAVGVRVELLPVWYDVDSIADLWRPGLAGAGTVAPL
FT                   TAEFVSGLISAHPPDTPPPAGER"
     ttgtccgctg taaaccccct gcccatgagc cttcagccat gtcgaaaagc tttgatgatc        60
     ttcgccaaaa gaccgatggc cggccgggtg aagacacggc tgaccccccc cctctctccc       120
     ggggatgccg ctgagctcta ccggcggatg ctgctggata tccttgcgaa gtgtgcccga       180
     atggtcggcg tggatctcct gctcttctac gagcccgggg aaggaagcgg ccgtttcttt       240
     gaagaggcgg ctccggggtg ggcatgtcgt ccccaggagg ggggtgatct gggggcgcgg       300
     ctcgattcgg cctttcggct tgctttcggt gaagggtatg gtgaagttgc cgtgatcggt       360
     accgactccc ccgacctgcc tgaagagtat gtgcggctgg cgttcgatct gttggaccac       420
     cgggcggtgg acgcggtcta tggtccctct gaagatggcg gttactacct cctggctctg       480
     aagcaacacc ggccggagct tttccgcgat atcccctggt ccaccgggga ggtcctggag       540
     cactcgctgg ctcgagccaa ggcggtaggc gtgcgggtcg agctcctccc tgtctggtat       600
     gatgtggata gcatcgccga tctgtggcgt ccggggctgg ccggggccgg caccgtggca       660
     ccacttacgg cggaattcgt ttccggcctt atttcagcac atccaccaga taccccaccc       720
     cctgcaggtg agagataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page