(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE47

CP002031.PE47        Location/Qualifiers
FT   CDS_pept        complement(54770..55219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82910"
FT                   /protein_id="ADI82910.1"
FT                   /translation="MDTTVIDEAIDKYVHERMEKGKTRAAERFLSYAYLKYAGDEVGEF
FT                   LRKAKGLTRYYVDFLTLMENPFKGPELAWFASMIVVGIVSCVMLSEEQTRLAGIFILSG
FT                   TLVHAWSLLRMVAKKWREIGVMIAIYREIIEIIERETSSLPSSAR"
     atggacacta cagtgatcga cgaagccatc gataaatacg tgcacgaaag gatggagaag        60
     ggaaaaacgc gtgctgcgga acgcttcctg tcctatgcct atctcaaata tgcaggggat       120
     gaggtgggcg agtttctgcg caaggcaaag gggctgaccc gctactacgt cgactttttg       180
     accctcatgg agaacccctt caaggggccg gagctcgctt ggtttgcctc catgatcgta       240
     gtcggcatcg tctcgtgcgt catgctcagc gaagaacaga ccaggctggc cggtattttc       300
     atcctgtcgg gaaccctggt gcacgcctgg tccctgctcc ggatggttgc aaagaagtgg       360
     cgcgaaatag gcgtgatgat cgccatttat cgcgagatca tcgagattat cgagcgggaa       420
     acatcatcgc tcccatcctc agcccgataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page