(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE475

CP002031.PE475       Location/Qualifiers
FT   CDS_pept        514710..515840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0482"
FT                   /product="DUF362 iron-sulfur cluster-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83345"
FT                   /protein_id="ADI83345.1"
FT                   /translation="MHTVAVERAARYDPSEVAEAMDRALASLGGMDTFVRPGERVLIKP
FT                   NMLAAKAPERAVTTHPEVLRAVIRLVRKAGGIPLVGDSPGIGGFRAVAEKSGMAAVVRE
FT                   AGAELVPFDEAVAVPGSGLFRRMDVARPYLEADRLINLPKLKTHEMMTMTCAVKNLFGA
FT                   VVGTAKAGWHLKAGADRELFARLLLEIYLLRPPDLTIVDGIVAMEGDGPGSGDPRPMGL
FT                   ILAGANAVAVDVVAAELAGIPKQLLWVERAAERLGIDGWDRSRIATVGLPPDDARVPDF
FT                   RLPHLSDVQFGIPGFLKNRLRHHLTARPVPNPEGCHLCGACLDACPPRAISVRDGRLHF
FT                   DYHACIRCFCCRELCPDSSLGVRDGVLLKLLKKFKE"
     atgcacacgg tagccgtcga acgggccgca cgctacgatc cttcagaggt tgccgaagcc        60
     atggaccggg ccctcgcttc cctgggagga atggatacct ttgtccgtcc tggtgagcgg       120
     gttctgatca agccgaacat gctggctgcc aaggcacccg agcgggcagt gaccacccac       180
     ccggaggtgc tgcgggccgt gattcggctc gtccggaagg ccggcggaat cccgctggtg       240
     ggcgattctc ccggtatcgg cggctttcgg gccgtggcgg aaaagagcgg catggctgcc       300
     gtcgtccggg aggccggtgc cgaactggtc ccgtttgacg aggctgttgc cgttccgggc       360
     agcgggctct tcaggcgtat ggatgtggcg cgaccctacc tggaagccga tcggctcatc       420
     aaccttccca agctcaagac ccacgagatg atgaccatga cctgcgccgt gaagaatctt       480
     ttcggcgcag tggtcgggac cgccaaggcg ggctggcatc tcaaggccgg cgccgaccgg       540
     gagctgtttg cccggcttct cctggaaatc taccttctga gaccaccgga tctgaccatc       600
     gttgacggca ttgtggccat ggagggtgat ggtccgggca gcggagaccc caggccgatg       660
     gggctcattc tggctggagc caatgccgtg gcggtggatg tggtagccgc ggaactggcg       720
     ggtattccga agcagctcct ctgggtcgag cgtgccgccg aacggctcgg catcgacggc       780
     tgggaccggt cccgcatcgc gacggtcgga ctcccgcccg acgatgcccg ggtgccggac       840
     tttcgcttgc cgcacctgtc ggacgtccag ttcggcatcc ccggtttcct caagaaccgg       900
     cttcgtcatc atctcactgc gcggccggtg ccgaaccccg aggggtgcca cctgtgcggg       960
     gcgtgccttg acgcctgtcc tccacgggcc atctccgtgc gcgacgggcg tctccatttc      1020
     gactaccacg cctgcatccg ctgcttctgc tgccgcgaac tctgccccga cagctccctc      1080
     ggggtacggg atggagtgct gctgaaactg ctcaagaaat tcaaggagta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page