(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE476

CP002031.PE476       Location/Qualifiers
FT   CDS_pept        516140..517348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0483"
FT                   /product="efflux pump, RND family, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83346"
FT                   /protein_id="ADI83346.1"
FT                   /translation="MKKAAIIAAVVIVAVAGIYFAFGKREPERTYKTAKVERGDVVATV
FT                   SATGNLSAVTTVQVGTQVSGTIYRLLVDYNTPVKKGQVIAEIDPALFRADVEQARGNLL
FT                   SAQANLLKARATAADAKRTMERNRQLVKEGVVSQSDFDTAETGAQEAAAAVKAAEASVV
FT                   QTRGALSRAETNLKNATIRSPVDGVVISRAVDVGQTVAASFQTPTLFTIAQDLTRMQIE
FT                   TSVDEADISRVRMGQQVTFTVDAYPDEKFNARVAQIRNAPVITQNVVTYVVVITVDNPD
FT                   LKLKPGMTANVAIEVGKKEKVLKVPMAALRFKPRADGDEGERRAPSGPAKAKREAGQQV
FT                   FILSPEKKPVPVKVQTGLGNDSHVEIVSGALKEGDEVIVQETTPRDKQKSGGSGRSPMG
FT                   MRF"
     atgaaaaaag cagccatcat cgcggcggtt gtcatcgtag ccgtagcggg aatctatttc        60
     gccttcggca agcgtgaacc cgaacggacc tacaagactg caaaagtgga acggggcgat       120
     gtcgttgcca ccgtctccgc cacgggcaac ctgagcgccg tcactaccgt tcaggtcggg       180
     acccaggtct ccggcaccat ctatcgcctg ctcgtggact acaatacccc cgtgaaaaag       240
     ggacaggtca tcgccgagat cgatccggca ctgtttcggg ccgacgtgga gcaggcaagg       300
     ggcaaccttc tgagcgcgca ggcgaatctc ctgaaagcca gggccactgc cgccgatgcc       360
     aagcggacca tggagcgcaa ccggcaactg gtcaaggagg gagttgtctc ccagagcgac       420
     ttcgacaccg ccgaaaccgg tgcccaagag gccgccgccg ccgtcaaggc cgctgaagcc       480
     tcggtcgtcc agacccgggg tgccctgtcc cgggcggaaa ccaacctgaa gaacgccacc       540
     atccggtcgc cggtggatgg tgtcgtcata tcccgggccg tggacgtggg acagaccgtg       600
     gccgcctcct tccagacccc gaccctgttc accatcgccc aggatctcac ccggatgcag       660
     atcgagacca gcgttgacga ggccgacatc agccgcgtgc ggatgggaca gcaggttacc       720
     ttcaccgtgg atgcctaccc ggacgagaag ttcaatgccc gggtggccca gatccgcaat       780
     gccccggtca ttacccagaa tgtggtcacc tacgtggtgg ttatcaccgt tgacaacccc       840
     gacttgaagc tcaagccggg catgactgcc aatgtggcca ttgaggtggg caaaaaggaa       900
     aaagtgctca aagttccgat ggctgcactg cggttcaagc cccgcgcgga cggtgacgag       960
     ggtgagcgcc gcgctccgtc cggtccggca aaggcgaagc gggaggcggg acagcaggtc      1020
     ttcatcctgt caccggagaa gaagccggtg ccggtgaagg tacagaccgg tctcggcaac      1080
     gacagccatg tggagatcgt ctccggagcc ttgaaggagg gagacgaggt gatcgttcag      1140
     gagaccactc ccagggataa acagaagagc ggcggcagcg gcagatctcc catggggatg      1200
     cggttctag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page