(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE478

CP002031.PE478       Location/Qualifiers
FT   CDS_pept        518053..519279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0485"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83348"
FT                   /protein_id="ADI83348.1"
FT                   /translation="MNLLMSLRISLRALLANKMRSFLTMLGIIIGIAAVIIIVAIGSGA
FT                   QKVVSDVIASIGSNIILVIPGSTTSGGLRIGAGSVPSLTQDDARAINTELPSVLRAAPT
FT                   VRGTAQVVAGNMNWSTMIMGVTPEFLQVREWQVVSGRELSPSDIEGASKNCILGQTVAE
FT                   NLFGSEDPIGKTVRIKRVPFIVVGLLDRKGQSPQGSDQDDIILLPLSTAQRKILGSQFP
FT                   NTVGAIMVQAKSRELMDQAEEELTTLLDQRHRIGPAKERDYTVRNLTEILAASEQSQKM
FT                   LTILFGAVASISLIVGGIGIMNIMLVSVTERTREIGIRMAIGARQRDILLQFLAEAVLL
FT                   TLLGGVIGMAIGIGGATLISQFFGWPTMISSKAILLAFAFSGGVGIFFGFYPARKAAGL
FT                   NPIEALRYE"
     atgaacctcc tcatgagcct ccggatctcg ttgcgggccc tgctcgccaa caagatgcgc        60
     tcatttctca ccatgctcgg tatcatcatc ggcatcgcgg ccgtcatcat catcgtggcc       120
     atcggcagcg gcgcccagaa ggtggtgtcc gacgtcatcg ccagcatcgg cagcaacatc       180
     attctggtaa tccccggctc caccaccagc ggcgggcttc gtatcggcgc cggctcagtt       240
     ccctccctga ctcaggacga tgcccgagcc attaacaccg aactcccctc ggtgctgcgc       300
     gctgccccaa cggtgcgggg caccgctcaa gtggtggccg gcaacatgaa ctggtcgacc       360
     atgatcatgg gggttacgcc ggagtttctg caggtgcggg agtggcaggt ggtgtcgggg       420
     cgtgagcttt ccccttcaga catcgagggg gcctcaaaga actgtatcct tgggcagacc       480
     gtggccgaga atctcttcgg ttccgaagat cccatcggca agaccgtccg gatcaagcgg       540
     gttcccttca tcgtggtcgg gctgctggac cgcaaggggc agtcccctca ggggagcgac       600
     caggacgaca tcattctgct tcctctgagt acggcccagc gcaagatcct cggttcccag       660
     tttcccaaca ccgtgggggc gatcatggtg caggccaaga gccgggaatt gatggatcag       720
     gccgaagagg aactgacaac gcttctcgac cagcgccacc ggatcggtcc ggccaaagag       780
     agggactaca cggtgcgtaa cctgaccgag atcctggccg cctcggagca gtcccagaag       840
     atgctcacga ttctcttcgg tgctgtggca tccatttcac tgatcgtggg cggcatcggc       900
     atcatgaaca tcatgctggt atcggtcacg gagcgaacgc gggagatcgg catccggatg       960
     gccatcggcg cccggcagcg cgacattctc cttcagtttc tggccgaggc ggtgcttctg      1020
     acacttctgg ggggagtcat cggcatggcc attggcatcg ggggggccac gctgatttcg      1080
     cagttctttg gctggcccac gatgatttca tcaaaggcaa tcctgctcgc ctttgccttc      1140
     tccggcggag tcgggatatt tttcggattc tatccggcac gcaaggctgc ggggctcaac      1200
     cccatcgagg cactgcgcta tgaatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page