(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE479

CP002031.PE479       Location/Qualifiers
FT   CDS_pept        519310..519480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83349"
FT                   /protein_id="ADI83349.1"
FT                   /translation="MKTLLVFLAVTLLNGAFLYPLFYLGLGREVSWWLVAAMVVVGAFC
FT                   IYLLVRYRKSL"
     gtgaagacgc tgctggtgtt tctggccgtg accctgctga atggggcgtt tctctatccg        60
     ctgttctatc tggggctggg gagggaggtg tcgtggtggc tggtggccgc catggtcgtc       120
     gtcggtgcgt tctgcatcta cctgctggtg cgctatcgca aaagtctgtg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page