(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE487

CP002031.PE487       Location/Qualifiers
FT   CDS_pept        524779..525195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83358"
FT                   /protein_id="ADI83358.1"
FT                   /translation="MDAVKRHLTALLRVALGAVFLYAAVIKIANPPAFAGNVAAYQLLP
FT                   YAGNYLVAAILPWIEAICGLLLVTGWRARSAAALVAVMNILFIVLLISTVARGLDIDCG
FT                   CFRQGGEKTSAWTAIFRDIMLLVAAVFVFRKTKQ"
     atggatgcgg tgaaacgtca cctcacggca ctgctgcggg ttgctctcgg cgcggtcttt        60
     ctctacgcag ctgtcattaa gatagctaat cctcccgcct ttgccggcaa tgtggccgcc       120
     taccaactgc tcccgtatgc cggcaactac ctggtagcag ccatcctgcc atggattgag       180
     gcaatctgcg gtttgttgct cgtcacgggc tggagagccc gcagcgccgc agccctcgtg       240
     gcggtcatga acatcctgtt tatcgttctg ctcatttcca ccgtggcccg ggggcttgac       300
     atcgactgcg gctgcttccg ccagggggga gagaaaactt ctgcctggac ggccattttc       360
     cgcgatatta tgttgcttgt tgcggccgtt ttcgtctttc gcaaaacaaa acaatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page