(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE494

CP002031.PE494       Location/Qualifiers
FT   CDS_pept        534833..535426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0502"
FT                   /product="dephospho-coenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83365"
FT                   /protein_id="ADI83365.1"
FT                   /translation="MNIIGLTGGIASGKSTVSRILERLGAVVIDADQLAREAVMPGTSA
FT                   HRSIVAAFGEGILLPDGAIDRKALGSIIFADSSARKRLEAITHPAIRDLAELRLAELRR
FT                   SGVPVAVYMAALLIEAGATDRVDEVWVVYVDRETQVRRVMARDGLSRSEAEQRLAAQMP
FT                   MEEKAARGQVVIDNNGTPEELERRIEEIWAKRFP"
     atgaacataa tcggacttac cggtgggatc gcttcgggga agagtacggt gtcgcggatt        60
     cttgagcggc tcggagcggt ggtgattgat gcggatcagc tggcccgtga ggcggtcatg       120
     ccgggtacgt ccgcccatcg gtccatcgtg gcggccttcg gcgaggggat tctgctgcct       180
     gacggtgcca ttgaccggaa ggctctcggc agcatcatct tcgccgactc ctctgcccgg       240
     aaacggctgg aggcgataac acacccggcc atcagggacc ttgccgagct gcgtcttgcc       300
     gagctgcgcc ggtccggcgt gccggttgcc gtgtacatgg ctgcgctcct gatcgaagca       360
     ggcgcaaccg atcgggttga cgaggtctgg gtagtgtatg tggaccggga aactcaggtc       420
     cggcgtgtaa tggcgcggga tggtctgagc cgctcggagg ccgagcagcg gctggcggcc       480
     cagatgccca tggaggagaa ggctgcgagg gggcaggtgg tcatagacaa caacggcaca       540
     cctgaagagt tggagcgacg gatcgaggag atctgggcga agcgcttccc atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page