(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE504

CP002031.PE504       Location/Qualifiers
FT   CDS_pept        complement(544493..546283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0512"
FT                   /product="pyridoxal-5'-phosphate-dependent
FT                   chorismate-binding enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83375"
FT                   /protein_id="ADI83375.1"
FT                   /translation="MSGAPTVILASFDAERHSASYRFEEFVEAVTALTPAEVVPALRRV
FT                   EAAVAGGLHAAGFVSYEAAPGLDETLTTREPVPDTPLVWFGLFRRRIGFAPRLPECEQD
FT                   VPPGYETSQWSATLQREPYLESVGRIRQYITAGDCYQVNFTFRQQFRFTGDPQAWFHDL
FT                   CRAQRAPFCAFIDTGSLRVLSTSPELFFDLRQGTLTCRPMKGTARRGRWRAEDEELRAG
FT                   LAASEKERAENLMIVDLLRNDMGMVAETGSVRVESLFDVESLETLHQMTSTITARPQAG
FT                   VGLADLFRALFPCGSVTGAPKRRSMEIIRELEDSPRGIYTGAIGYVSPAAQGAPAPFEA
FT                   TFSVAIRTVVLDAASGQGQLGIGSGVTIGSTPSSEYDECLAKSRFARERVPDFQLVETL
FT                   LHEEGAGFFLLERHLARLYRSAAHFGIPLRLGSLQEILNRRAALMEGRQKVRVLVNRRG
FT                   AFTIQEAPLTEAPCPEPIPVRFAATSVDPADQFLYHKTTYRPLYRHELAAAPDCADVIF
FT                   VNRHGEVTEGTTANVAARIDGEMVTPPLAAGILPGTFREELLAEGALRERPITREELER
FT                   CPEIYLINSVRRWRPVTLIT"
     atgagcggcg cgcccacggt cattctcgcc tctttcgatg ccgagcggca ttcggcctcg        60
     taccggttcg aggagtttgt ggaagccgtg acggccctga cccctgccga ggtcgtgccg       120
     gccctgcgcc gggtggaagc ggcggtggcc ggcggtctcc acgcggcggg attcgtcagc       180
     tatgaggcgg cgcccggcct ggacgaaacc ctgacaaccc gcgaaccggt gccggacacc       240
     ccgctggtct ggttcggcct gttccgccgc cgcatcggct ttgcgccccg gctccccgaa       300
     tgcgagcagg acgtgccacc cggctacgag accagccagt ggagcgccac gctccagcgg       360
     gagccctacc tggagtcagt cggtcggatc aggcagtaca taacggccgg cgactgctat       420
     caggtcaact tcaccttccg ccagcagttc cgcttcacgg gcgatcccca ggcatggttc       480
     cacgatctct gccgggccca gagagcccct ttctgtgcct tcatcgatac gggatcgctc       540
     cgggtcctct ccacctcgcc cgaactgttc ttcgacctgc gccaggggac cctcacctgc       600
     cgccccatga agggaaccgc ccgcagggga cgctggcggg ccgaggacga ggagttacgc       660
     gcgggacttg ccgccagcga gaaggagcgg gccgaaaacc tgatgatcgt cgacctgctg       720
     cgcaacgaca tgggaatggt ggctgaaacg ggctcggtgc gggtggagtc gctctttgac       780
     gtggaaagcc tcgaaacgct ccaccagatg acctccacca tcacggcccg gccgcaggcc       840
     ggggtcggcc tcgccgatct cttccgggcg ctcttcccct gcgggtcggt gaccggtgcg       900
     cccaagcggc ggagcatgga gataatccgg gagctggagg attcgccccg ggggatctac       960
     accggcgcca tcggctacgt ctccccggcg gcgcaggggg cacccgcccc ctttgaggcg      1020
     accttcagtg tcgccatcag gacagtggtc ctggacgccg catcggggca ggggcagttg      1080
     ggcatcggca gcggtgtgac catcggctcg accccttcgt cggagtatga cgagtgcctc      1140
     gccaagagca gattcgcccg ggagcgtgtc cccgacttcc agttggtgga gacgctgctc      1200
     cacgaggaag gagcgggatt tttcctgctg gagcgccatc tggcgcgact ctaccggtca      1260
     gccgcccatt tcgggattcc gctccggctc ggcagcctcc aggagatcct caaccgacgg      1320
     gccgccctga tggagggtcg gcaaaaggtg cgcgtactgg tgaaccggcg gggggcgttc      1380
     accatccagg aagcaccgct gaccgaagcg ccctgcccgg aaccgattcc cgtccgcttt      1440
     gcggccacgt cagtggaccc ggccgatcag ttcctctacc acaagaccac ctaccgcccc      1500
     ctctaccggc acgaactggc ggcggcgccc gactgcgcag acgtcatctt cgtaaaccgg      1560
     cacggtgaag tgaccgaggg aaccacggcc aatgtggccg cccgcatcga cggggaaatg      1620
     gtcacccctc cccttgccgc cggcatcctc cccggcacct tccgggaaga gctcctggcc      1680
     gagggcgccc tccgcgaacg gcccatcacg cgggaggaac tggaacggtg cccggagatc      1740
     tacctcatca actcggtccg ccggtggcgg ccggtgactc tcatcacctg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page