(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE508

CP002031.PE508       Location/Qualifiers
FT   CDS_pept        complement(548401..550095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0516"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83379"
FT                   /protein_id="ADI83379.1"
FT                   /translation="MKVLASELAYFLRGRARQNLKVLLLYCAFLLVMLLAYASIFRYLM
FT                   WHLEGREYSFMAGIYWTITVMTTLGFGDITFQSDAGYLFASIVTVSGVIFLLIILPFGF
FT                   VSMFLAPWIERRLRYHPTIELPDDTRGHILIFGIDPITRTLIRKLESRNHLFVVVTDNY
FT                   DQALHLEEQEGFKVVYGSPTDAHVLAGLRVAAARSIIANLSDPDNANLCLTVRSLCQTP
FT                   IIAVVKEPVHGELLRLAGANQVVPLTRILGRYLGIRATTCGALAHILDSFGNLQIAELP
FT                   VHGTPFAGKTIGESGIRQRTGLSIIGVWERGSLTTPQRETVLTEQSLLVLAGTKSQLAA
FT                   LEYLIGEAPEDELIFIIGHGRIGCAAAAFLDRKPVPFILIDRQESPVCNDHVVVYGDAT
FT                   VGQTLRQAGIDRASGIIVTTNDDSTNIFLTLACRHLHSHIRIVARANGEENVDQLYAAG
FT                   ADFVVSNASVGANILGNLLEHKESAFLSEGMAVFRRPLPPAMAGKTIAETRLRPLTGCS
FT                   IVAIEAPDRADILISPPPETILAEGARLILIGTSEQEKTFDQTIAAR"
     atgaaggtac tcgcctccga actggcctat ttcctgaggg gccgcgccag acagaacctg        60
     aaggtcctgc tcctgtattg cgccttcctt cttgtcatgc tcctggccta cgcgtccatc       120
     ttccgctacc tgatgtggca tctcgaagga cgcgaatact cgttcatggc ggggatctac       180
     tggactatca cggtgatgac caccctcggg ttcggcgaca tcaccttcca gagcgacgcc       240
     gggtacctgt tcgcctctat tgtcaccgtt tcgggggtga tctttctcct gatcatcctc       300
     cccttcggct ttgtcagcat gttcctggct ccctggattg aacggcgcct ccgctaccac       360
     cccaccatcg agctgccgga cgacacccgg gggcacatcc tcatcttcgg catcgacccc       420
     atcacccgga ccctgatccg caaactggag agccgcaacc acctgttcgt cgtggtaacg       480
     gacaactacg accaggccct gcacctggaa gagcaggagg ggttcaaggt ggtctacggt       540
     tcgcccaccg atgcccacgt cctggccggc ctgcgggtgg cggcggcccg aagcatcatt       600
     gccaacctga gcgaccctga caacgccaac ctgtgcctca ccgtccgctc cctctgccag       660
     acccccatca ttgccgtggt caaggaaccg gtgcacggag aactgctccg gctggccgga       720
     gcgaaccagg tcgtccccct gaccagaatc ctcggccgct acctgggcat ccgggccacc       780
     acctgcgggg cgctggccca tattctcgac tccttcggca acctgcagat cgccgaactg       840
     cccgtccacg gcaccccttt cgccggcaaa accatcgggg aatcggggat tcgccagcgg       900
     acggggcttt caatcatcgg tgtctgggaa cggggcagcc tcaccacccc gcaacgggag       960
     acggtcctga ccgagcagtc gctgctggtg ctggccggca ccaagagcca gttggccgcc      1020
     ctggagtatc tgatcggcga ggcaccggaa gacgagttga tcttcatcat cggccacggc      1080
     cgcatcggct gcgccgccgc agcgttcctc gaccgcaagc cggtcccctt catcctgatc      1140
     gaccgccagg agagccccgt ctgcaacgat cacgtcgtgg tctacggcga cgccaccgtg      1200
     ggccagaccc tcaggcaggc gggcatcgac cgcgccagcg gcatcatcgt caccaccaat      1260
     gacgacagca ccaacatctt cctgaccctg gcctgccggc acctccactc ccacatccgc      1320
     atcgtggccc gtgccaacgg ggaggaaaac gtcgaccagc tctacgctgc cggcgccgac      1380
     ttcgtcgtct ccaacgcctc ggtgggtgcc aacatcctgg gcaacctgct ggagcacaag      1440
     gaatcggcct tcctctccga ggggatggcc gtcttccggc ggccgctgcc ccccgccatg      1500
     gccggcaaaa ccattgccga gacccgcctg cgccccctca ccggctgctc catcgtggcg      1560
     atcgaggcgc ccgaccgggc cgacatcctc atttcgccgc caccggaaac catcctcgca      1620
     gaaggggcca gactcatcct gatcggcacg tcggaacagg agaaaacctt tgatcagacc      1680
     attgccgccc gctaa                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page