(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE51

CP002031.PE51        Location/Qualifiers
FT   CDS_pept        58076..58675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82914"
FT                   /protein_id="ADI82914.1"
FT                   /translation="MRKTEGPFTREIACQQILMEDSSVFSVQWTTVPSDLRPRLSAEFL
FT                   LERYLAYIRRFTLTLIRPMVAADGIAFRLAGTRRSLILFTPPARREGPGHESLSLRICG
FT                   GFLVQGRQCDRGELSFMLDDDVSGVRLTLRLTDYCPLLLGSSEPSRLRKWLYRFTQAYI
FT                   HKVVTVRFLARVYADLAGGGGCVRVVRARVREGEDL"
     atgcgcaaaa cggaaggtcc gttcacgaga gagatagcct gccagcagat cctcatggag        60
     gattcctctg tattctcggt ccagtggacg acggtaccct cagacctccg cccgcggctt       120
     tccgctgagt ttctcctcga gcggtacctt gcctacatcc ggcgcttcac gcttaccctg       180
     atccggccga tggtcgcggc ggacggtatc gccttccgtc tggccgggac gcgccggagc       240
     ctgattctct ttaccccgcc ggcacgacgg gagggtcccg gccatgaatc gctctccctc       300
     cgcatctgcg gcggattcct ggttcagggc cgtcagtgcg accgcggaga gctttcgttc       360
     atgctggatg acgacgtttc cggggtgcgt ctcactctgc gactgaccga ctactgcccg       420
     ctgctgctcg ggagcagtga accgtcgcgg cttcggaaat ggctctatcg cttcacgcag       480
     gcttacatcc acaaagtggt gacggtccgt ttcctggcac gggtatatgc tgacctggcc       540
     gggggcggag ggtgcgtgcg ggtggtccgg gcgagggtcc gggaaggcga ggatctgtag       600
//

If you have problems or comments...

PBIL Back to PBIL home page