(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE513

CP002031.PE513       Location/Qualifiers
FT   CDS_pept        553355..553564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83384"
FT                   /protein_id="ADI83384.1"
FT                   /translation="MELKNKIWMTGNLDWFAYIGDEEVWLGRREVPIPLDEGDRWTNSL
FT                   GFVFEVRNAEIVVVEKVEPPNITW"
     atggaactga aaaataagat ctggatgacg ggcaaccttg actggtttgc ctatatcggc        60
     gacgaagagg tgtggctcgg tcgccgtgag gtgccgatcc cccttgatga aggggaccgc       120
     tggacgaatt cgctcggctt tgtgttcgag gtcaggaacg cggagatcgt cgtggttgag       180
     aaggtggagc caccgaatat cacgtggtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page