(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE518

CP002031.PE518       Location/Qualifiers
FT   CDS_pept        556567..558786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0526"
FT                   /product="sensor diguanylate cyclase/phosphodiesterase, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, GGDEF, EAL"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83389"
FT                   /protein_id="ADI83389.1"
FT                   /translation="MPLRKNHNLKETLHEMVLGVSVAVGDQFFHSLLEHLTRALDVEYA
FT                   FIAEYTDREAMRVKTVAFRADGQEAEPLEFDLVGTPCERVVLDAYYCTPEGVCTLFPLD
FT                   HLAMAMGVEGYAGIALTDAAGNVLGPLAVLSRRPLGDSELAETMLRIFAARASAELERT
FT                   KAEQARREQLHFLQVLIDSIPHPIFYKDADRRYIGCNAALESFIGRTREEIIGKTVFDI
FT                   GAEGRARICDAVDRKLLANGGVESYDSTMIHTDGSIRDIIFSKTVFGNTDGSIGGIVGT
FT                   ILDITERKRAEEAIQQLAYFDALTGLPNRTLLRDRVSQLLSQARREGGGFGVLHLDVDR
FT                   FKGVNDSLGHACGDVLLSTVAGRIASSIRESDTVARLGSDEFVVILPGVGHEEDVVAVV
FT                   RKIVEELNRPIVIQGNDIFCTASIGIAIYPTDGSSADILLKNADMAMHKAKEFGGDGYQ
FT                   FYSSELNHRAMERLTLETSLRRALERREFLLHYQPLLGIGSGRIVGVEALLRWDSPELG
FT                   MVSPARFIPLAEETGLIVPIGEWVLRSACEQLRALHELGYTELCVSVNVSARQFRHDGF
FT                   CAMVAAVLAAVGLDPRYLELELTESVIMERSETAKGILRKLKQMGVSLAIDDFGTGYSS
FT                   LSYLKHFPIDRLKIDRTFVKEVTVDQDNAAIAEAIVALAHVLNLDVVAEGVETAEQLAF
FT                   LAALRCDVVQGYHIARPLPPRNLLEFLEARQEDRAARPMLRSLQP"
     atgcccttgc gcaagaatca caatctgaag gaaaccctcc acgaaatggt tctcggcgta        60
     tcggtcgccg tgggggacca gtttttccac tccctgctgg agcatctcac cagggcactg       120
     gatgtggaat acgccttcat cgccgaatat accgaccggg aggccatgcg ggtgaagacc       180
     gttgccttcc gtgccgacgg gcaggaggcg gagccccttg aattcgacct ggtgggcact       240
     ccctgcgagc gggtggttct ggatgcctac tattgcactc ctgaaggggt ctgcacgctg       300
     ttccccctgg accatctggc catggccatg ggggtcgagg ggtacgcggg gatcgccctg       360
     accgatgcgg cgggcaacgt tctggggccg ctggccgtct tgagccgccg gccgctgggc       420
     gacagcgagc tggcggaaac gatgctccgg atcttcgcgg cccgcgcctc ggccgagctg       480
     gagcggacca aggccgagca ggcccggcgc gagcagctcc acttcctcca ggtcctcatc       540
     gactccatcc cccatcccat cttctacaag gacgccgacc ggcgttatat cggctgcaat       600
     gccgccctgg aatcgttcat cgggcgcacg cgcgaggaga ttatcggcaa gacggtcttc       660
     gacatcggcg cggagggccg ggcgcgcatc tgcgatgccg tggaccgcaa gctgctcgct       720
     aacggcgggg tggaaagcta cgacagcacc atgatccaca ctgacggcag catccgtgac       780
     atcatcttca gcaagacggt cttcgggaat accgacggtt ccatcggcgg catcgtcggc       840
     acgatcctcg atatcaccga acgcaagcgg gccgaggagg ctatccagca actggcctat       900
     ttcgatgcgc tcacgggact gccgaaccgg accctgctca gggaccgcgt cagccagctg       960
     ctgtcccagg cgcggcggga ggggggaggt ttcggcgtcc tgcacctgga tgtggaccgg      1020
     ttcaaagggg tgaatgactc gctggggcat gcctgcggcg acgttctgct ctccaccgtg      1080
     gccggacgga tcgcttcgag tatccgggag agcgacaccg tggcgcggct ggggagcgac      1140
     gagttcgtgg tgattctgcc gggggtgggg cacgaagagg acgtggtggc ggtcgtccgc      1200
     aagatagtgg aagagctgaa ccggcctatc gtcatccagg gtaatgatat cttctgcacc      1260
     gccagcatcg gcatcgccat ctatccgacg gacggttcca gtgcggacat cctgctcaaa      1320
     aatgccgaca tggccatgca caaggccaag gagttcgggg gtgacggcta ccagttctac      1380
     tcgagcgagt tgaaccaccg ggccatggag cggctgaccc tggagaccag cctgcgccgc      1440
     gcgctggagc gccgggagtt tctcctgcac taccagccgc tgctcggtat cgggtcaggc      1500
     cggattgtcg gggtggaggc actgttgcgg tgggactcgc cggaactggg catggtgtcg      1560
     ccggcccgtt tcatccccct ggccgaggag acggggctca tcgtgccgat cggcgagtgg      1620
     gtcctgcgct cggcctgcga acagctcagg gccctccacg agctgggcta caccgaattg      1680
     tgcgtgtccg tgaacgtgtc ggcgcggcag ttccggcacg acgggttctg cgccatggtg      1740
     gccgccgtgc tggcggcagt ggggctcgat ccccggtatc tggagctgga acttaccgag      1800
     agcgtcatca tggagcgctc agagacggcc aaggggattc tgcggaagct gaagcagatg      1860
     ggggtgtcgc tcgccatcga tgattttggt accggctact catccctgag ttacctgaag      1920
     cactttccca tcgaccggct caagatcgac cgcacctttg tcaaagaagt gaccgtggac      1980
     caggacaatg ccgccattgc cgaggcgatc gtcgccctgg cccacgtgct gaatctggat      2040
     gtcgtggcgg aaggggtgga gaccgccgaa caacttgcct tcctggcggc gctccgctgc      2100
     gacgtggtcc aggggtatca catcgcccgt ccccttcctc cccggaatct gctcgaattc      2160
     cttgaagcgc ggcaggagga tcgtgccgcc cgccccatgc tcaggtcact tcaaccgtaa      2220
//

If you have problems or comments...

PBIL Back to PBIL home page