(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE520

CP002031.PE520       Location/Qualifiers
FT   CDS_pept        complement(559357..559533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83391"
FT                   /protein_id="ADI83391.1"
FT                   /translation="MMMEKQTEMIEQLAEDAEVTLSTDYERKDLKERRSVAKSSLYDGS
FT                   KKLKHSVPKGKRV"
     atgatgatgg aaaagcaaac ggaaatgatc gaacaattgg ccgaggatgc ggaagttact        60
     ctctccaccg actacgagcg caaagatctc aaggagcgcc gttcggtcgc caagagcagc       120
     ctctatgacg gctctaaaaa gcttaaacac agcgttccca aggggaagcg ggtatag          177
//

If you have problems or comments...

PBIL Back to PBIL home page