(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE521

CP002031.PE521       Location/Qualifiers
FT   CDS_pept        559789..559968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83392"
FT                   /protein_id="ADI83392.1"
FT                   /translation="MLTYKVVEIGTVTEDVIEEALNEWTAKGWRFDGMQFAMREASRRP
FT                   SMAFLIFTREAEEA"
     gtgctcacat acaaggtggt ggagatcggg accgtgacgg aggacgtcat cgaggaggcc        60
     ctcaacgaat ggaccgcaaa ggggtggcgc ttcgacggga tgcagttcgc catgcgcgag       120
     gcgagccgtc gtccctccat ggcgtttctc atcttcaccc gcgaagctga ggaggcgtag       180
//

If you have problems or comments...

PBIL Back to PBIL home page