(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE526

CP002031.PE526       Location/Qualifiers
FT   CDS_pept        565176..566102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0535"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83398"
FT                   /protein_id="ADI83398.1"
FT                   /translation="MIQAQTAAPPHAKVTAILLFTTLMWGGSFLFNKIGMREVPPVHFF
FT                   FFRFALAALLMGGVCLPRLARLNRHIAVRGAVVGLALAAVNLTFVLGVSGTTISRAGYL
FT                   NNLFVLFIPLLTFALWRERVDRVTFGGIALAVVGLWALASGGAEGFNQGDLLSTVCALF
FT                   IAIHIIAVSRVLRDEDVYLVTFVQFVTVAAVGLVLCLVLPWPEFTIGRAGAWSLAYCAL
FT                   FPTVICFTLQNAYQRFTTPTRAGLIYTLDPVWSMLFGVFILGERLTPRELAGCVLILMA
FT                   VAGPLLARLYLEQRHRRLYRLDGAEGT"
     atgatccagg ctcagaccgc ggcaccgccg cacgcaaagg taacggctat cctcctgttc        60
     accactctca tgtggggggg gagcttcctc ttcaacaaga tcgggatgcg cgaggtgcct       120
     ccggtccact ttttcttctt ccggttcgcc ctggcggcgc tcctcatggg gggggtctgc       180
     ctgccgcgtc tggcgcgcct caaccgccac atcgccgtgc gcggagcagt ggtcggcctg       240
     gccctggccg cggtgaacct caccttcgtc ctcggcgtgt cgggcaccac catctcccgg       300
     gccgggtacc tgaacaacct ctttgtcctc tttatcccgc tccttacgtt cgccctgtgg       360
     cgcgagcggg tcgaccgggt gaccttcggc ggcatcgccc tggccgtggt cgggctctgg       420
     gccctggcca gcggcggggc cgagggattc aatcaagggg atctcctctc cacggtctgc       480
     gccctgttca tcgccatcca catcatagcc gtttcccggg tgctgcggga cgaggacgtc       540
     tatctggtga ccttcgtgca gttcgtcacc gtggccgccg tggggctcgt cctctgcctg       600
     gttctcccct ggccggaatt caccatcggc cgggccgggg cctggtccct ggcgtactgc       660
     gccctctttc ccacagtcat ctgctttacc ctccagaacg cctaccagcg cttcaccacc       720
     cccaccaggg cggggctgat ctacaccctc gacccggtct ggagcatgct gttcggcgtt       780
     tttatcctgg gtgagcggct caccccccgc gaactggcgg gctgtgtcct catcctcatg       840
     gccgtggccg ggccgctcct ggcccggctc tatctggagc agcgccatcg gcggctctac       900
     cggctcgatg gcgccgaagg gacctag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page