(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE529

CP002031.PE529       Location/Qualifiers
FT   CDS_pept        complement(568882..570396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0538"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83401"
FT                   /protein_id="ADI83401.1"
FT                   /translation="MNVLLVYPRYPDSFWSFRHALKFVGKKAAFPPLGLLTVAALFPDT
FT                   WQARLIDQNVREVTDADLARADLVFVSAMTIQREAVREILGRCRQLGVTTVAGGPLFTT
FT                   APEEFPEADHLVLNEAELTLPRFLDDLAMDRAQRIYTAEARADVTRTPLPRWDLLDIRD
FT                   YAAMNIQYSRGCPFDCEFCDITRLFGRRPRTKGREQLTAELDGLHARGWQGGVFFVDDN
FT                   FIGDRAKLKREVLPAMIDWQEQRGRPFSFFTESSIDLADDPELMGLMVRAGFTEVFVGI
FT                   ETPHDEGLHESGKVQNRNRDLLESVKRIQRAGLQVQGGFIVGFDSDPETIFERQIRFIQ
FT                   ESGIVTAMVGMLTALRGTRLHRRLAQEGRLLRNASGNNTAIALNFVPRMPADALVGGYR
FT                   KILDTIYAPRHYYRRVITFLTEYRTPPGGFQPNPARLRAFLASVVLLGVIGRERLYYWK
FT                   LFFWSLARRPRLFPLAITLAIYGFHFRKVAESIGATGMFEEQECVE"
     atgaacgttc tcctcgtcta cccccgctat ccggattcct tctggagctt ccgccacgcc        60
     ctgaaattcg tcggcaagaa ggccgccttc ccgcccttgg ggctccttac cgttgccgct       120
     ctcttccccg acacctggca ggcgcgcctg atcgaccaga atgtccggga agtgaccgat       180
     gccgatcttg cccgtgctga tctcgttttc gtgagcgcca tgaccatcca gcgggaagcg       240
     gtgcgggaga tcctcggccg ctgccggcaa ctgggggtca ccacggtggc cgggggccct       300
     ctcttcacta ccgcgccgga ggagtttccc gaggcggacc acctggtgct caacgaggct       360
     gagctcaccc tcccgcggtt tctggacgac ctggccatgg accgcgccca gcgtatctat       420
     actgccgagg cacgggccga cgtgacccgg accccgctgc cacggtggga tctcctggac       480
     atccgggatt acgcggccat gaacatccag tattcccggg gctgcccctt tgactgcgag       540
     ttctgcgaca tcacccggct cttcggccgc aggccgcgca ccaagggccg ggagcagttg       600
     acggcggaac tggacggcct ccatgcccgc ggctggcagg ggggtgtttt cttcgtggac       660
     gacaacttca tcggcgaccg ggcaaagctg aaacgggaag tgcttcccgc catgatcgac       720
     tggcaggagc agcggggacg gcccttctct ttcttcaccg agtcctccat cgacctggcc       780
     gacgatcccg agctcatggg gctcatggtg cgggcggggt tcacggaggt ctttgtgggc       840
     atcgagaccc cccatgacga ggggcttcac gagagcggca aggttcagaa ccgcaaccgc       900
     gacctgctgg aaagcgtcaa acggatccag cgggcgggac tccaggtgca gggaggattc       960
     atcgtcggct ttgacagcga cccggagacg atcttcgagc ggcagatccg cttcatccag      1020
     gagagcggca tcgtgaccgc catggtcgga atgctcaccg ccctgcgggg gaccaggctt      1080
     caccggcgtc ttgcacagga gggacggctg ctgcggaacg cctcgggcaa caataccgcc      1140
     attgccctca acttcgtccc ccggatgccg gcggatgcgc tcgtcggcgg ttaccggaaa      1200
     attctcgaca ccatctatgc cccacggcac tactaccgcc gggtcatcac cttcctcacg      1260
     gagtaccgga ccccgccggg ggggttccag ccgaatccgg cccgactgcg ggcgttcctg      1320
     gcgtcggtgg tgttgctggg ggtgatcggg agggagcgcc tctactactg gaaactcttc      1380
     ttctggtcac tggcgcggcg gccacggctc tttcccctgg cgatcaccct ggccatctac      1440
     ggctttcact tccgaaaggt ggcggagagc atcggtgcca ccggcatgtt cgaggaacag      1500
     gaatgcgtcg agtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page