(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE534

CP002031.PE534       Location/Qualifiers
FT   CDS_pept        573194..573979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78314"
FT                   /protein_id="ADN78314.1"
FT                   /translation="MIESMEPTSWRDLQNVVARILRETGVITAVEKTIQTARGDVSIDV
FT                   WVHDPTATPTQTYLIECKRWRSRVPQTIVHAFRAVVGDSGANWGAIISIAGFQKGAIKA
FT                   AEYSNLRLLSWTEFQALFAERWFSHYFVSEIAKETDPLLEYTEPINSRIFKKADLLSED
FT                   LRQEFRRLRVEHQAIGMLCLLYRAHAASALRLVLGENAPTLMPSLPLRKTIGTYLDAEG
FT                   MPIADEILDASSYRTLLESIIREAKKAIAQFDEVFGERA"
     atgattgaat ccatggaacc gacatcatgg cgagatcttc agaatgtggt cgccaggata        60
     ctccgcgaga ctggcgtaat cacagcagta gagaagacca tacagactgc aaggggtgac       120
     gtctctatcg acgtgtgggt acacgatcct accgcgacac caactcagac ttatcttatc       180
     gagtgcaaac ggtggcgttc acgagtgccc cagaccatag tccatgcctt ccgggctgtt       240
     gttggcgact ccggtgccaa ctggggtgcc attatttcta tagcaggctt tcagaagggt       300
     gccataaaag ccgctgagta ttcaaatcta cgccttttgt cgtggacaga attccaggct       360
     ttgtttgccg aacgatggtt ttcacactac tttgtaagcg agattgcgaa ggaaactgac       420
     ccgttgttgg agtacaccga gccaatcaac tcgcgtatat tcaagaaggc ggatttgttg       480
     tcagaggact tacgtcagga atttaggcga ttgcgcgttg aacaccaagc tatcgggatg       540
     ctctgtctgc tatatcgagc ccacgcggca agcgcattac ggctggttct cggtgaaaac       600
     gcacctacac tcatgcctag tctaccgcta cggaaaacaa ttggaactta tcttgatgcc       660
     gaggggatgc caatagcaga cgaaattctc gacgccagct catatcgtac actcttagaa       720
     tcaatcatta gagaagcaaa aaaagcaatt gcacagtttg acgaagtatt tggagagaga       780
     gcgtag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page