(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE536

CP002031.PE536       Location/Qualifiers
FT   CDS_pept        575657..576148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0544"
FT                   /product="NrdH-like redox domain protein, YruB family,
FT                   DUF4124-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83407"
FT                   /protein_id="ADI83407.1"
FT                   /translation="MPIRILLPIVTLLLTCSLAGAEMYKWVDEHGVVTFKDTPPPATKK
FT                   GKKVKVYTDGDFAPAPSPQPAAPRRATSAPQPAPPVKQRFTGTVELYVTDWCGYCKWAE
FT                   RYLQSKGVSYVAYDIEKDSAAMQRHKDLGGRGVPLIVVGSHKISGFSPETIDYYLENGR
FT                   "
     atgccgatcc gcatcctcct ccccattgtc accctgctgc tgacctgttc ccttgccgga        60
     gccgagatgt ataagtgggt ggacgagcac ggggtggtga cgttcaagga cacgcctccg       120
     ccggcaacga agaaggggaa aaaggtgaag gtctacaccg acggcgattt cgcgccggcg       180
     ccgtctccgc aaccggcggc tccgcgcagg gctacgtcgg caccgcagcc cgcaccgccc       240
     gtgaagcagc gcttcaccgg cacggttgag ctgtacgtga ccgactggtg cggctactgc       300
     aagtgggcgg agaggtacct gcagagcaag ggcgtttcct atgtggccta cgacatcgaa       360
     aaggacagcg ccgccatgca gcggcacaag gatctggggg gccggggcgt gccgctgatc       420
     gtcgtgggtt cgcacaaaat ttccgggttt tcgcccgaga cgatcgatta ttatctggag       480
     aacggccggt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page