(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE538

CP002031.PE538       Location/Qualifiers
FT   CDS_pept        576763..577164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83409"
FT                   /protein_id="ADI83409.1"
FT                   /translation="MTSSILKACAIWLLFIPLGIVNGVVREKVLNPLVGAQVALPLSGV
FT                   SLGALIVAVTTLLIPLAGGLTPSRCRLIGWIWLVLTVFFEFFFGRVVMGHPWAKLLEAY
FT                   DPRGGNLWVAVLLVIAAAPYLAARLRGLV"
     atgacgtctt ccatcctcaa ggcatgcgcc atctggctcc tgtttatccc gctgggaatc        60
     gtgaacggcg tggtgcgtga aaaggttctg aacccgctgg tgggggcgca ggtggcgctg       120
     ccgctgagcg gcgtctccct cggcgccctg atcgttgcgg tcaccacgct cctgatcccg       180
     ctggcgggag gactaacccc ttcgcgctgc cggctgatcg gctggatatg gctggtgttg       240
     acggtctttt tcgagttttt cttcggccgc gtcgtcatgg ggcacccctg ggcgaagctg       300
     ctggaggcat acgacccgcg cggcgggaac ctctgggtgg cggtgctgct ggtgatcgcg       360
     gcggccccgt acctggcggc ccggttgcgg ggactggtgt ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page