(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE546

CP002031.PE546       Location/Qualifiers
FT   CDS_pept        584626..585069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0554"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83417"
FT                   /protein_id="ADI83417.1"
FT                   /translation="MTVTNMTEWFAKGVEALHHDHVYLARACFEQAVTEQRSPLSSSYL
FT                   ALCQAKTRGTFSDAIASAREAVAADPANPALYHNLGCIYLLAGKRTEAIETFRQGLRVG
FT                   GGEDITSELERLGTRRAPPIKRLPRNHPVNKYLGIVLSRLGLR"
     atgacagtga cgaatatgac ggaatggttt gccaagggag tcgaagccct ccaccacgac        60
     cacgtctatc tggcccgcgc ctgcttcgag caggcggtga cagagcagcg gtcaccgctt       120
     tcctcatcct acctggccct ttgccaggcc aagacgcggg gcaccttcag cgacgccatt       180
     gccagcgcac gggaggctgt ggcggctgat cccgcaaacc ctgcactcta ccataacctg       240
     gggtgcatct atctgctggc gggcaagcgg accgaggcca tcgaaacctt ccgccagggg       300
     ctgcgcgttg ggggcggaga ggatattacc agcgagctcg aacggctcgg cacccgccgt       360
     gctcccccca tcaagcgtct gccccgcaat caccccgtca acaagtacct ggggatcgtc       420
     ctctcccgcc tgggcctgcg gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page