(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE567

CP002031.PE567       Location/Qualifiers
FT   CDS_pept        complement(606924..607166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83438"
FT                   /protein_id="ADI83438.1"
FT                   /translation="MKTTSKALMVTLATGGTVWAASGAESEANGLLVTMFLAFGALIIV
FT                   FQLLPGLMLFAAMVKGLFIRPAKDIATGTSGNETA"
     atgaaaacga cgtcgaaagc actgatggta acactggcaa cgggagggac ggtatgggcg        60
     gccagcggcg ctgaatcaga agcgaacggc ctgctggtaa ccatgtttct cgcattcggc       120
     gcactgatca tcgtgttcca actcctgccg gggctcatgc tcttcgcagc gatggtcaag       180
     ggactgttta tcaggccggc gaaagatatc gccaccggaa catcgggcaa cgaaacggcg       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page