(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE577

CP002031.PE577       Location/Qualifiers
FT   CDS_pept        622071..623351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83450"
FT                   /protein_id="ADI83450.1"
FT                   /translation="MTSSDSNVDPGLGIAVDLGTTTLAASLVDLSSGERLASAGSLNPQ
FT                   REFGADVVSRLDAACRSGEALQRMAALVREELYRLAARLLDSAGEARDRLRMVAVAGNP
FT                   AMEHLLLGLPVVRLAYPPYRPLFSTSTHISAADLGWDLSGRVALFPLPGGFVGGDTVAF
FT                   LFGVPDVCAPCPGPRLFLDMGTNGEMVLQCGDVLLGTSAAAGPAFEGGGLACGMAALPG
FT                   AVNGIIRDGDRVRVTTIGGGQPLGICGSAVLDTVALLLEEGLLDSTGRLLPPEEIASPV
FT                   GARMGTVGGEPAFILHRDAARTIYLSQEDIRQVQLAKAAIRAGIEVLCERARIRCEDIE
FT                   EVVLTGSFGAVLSPRSLKFIGIFTGKMVQTTRFVREGALAGVEKALTAPEGFEAVDRLA
FT                   RALRVIPLSGTPAFEKHFLKHIDFPSR"
     ttgacatcgt ctgactccaa cgttgatcca ggcctcggca ttgccgttga cctgggcacc        60
     actacccttg ccgcttcgct ggtcgatctt tcatccgggg aaagactggc ttccgccggg       120
     tctctgaacc cccagcggga attcggcgcc gacgtggtct cgcggctcga tgccgcctgt       180
     cgttccggtg aggcactgca acgcatggcc gcgctggtca gggaggagtt gtaccgcctc       240
     gcggcccgtc tgctcgacag cgccggcgag gcacgggacc gcctgcgcat ggtggctgtg       300
     gccggcaatc ccgccatgga acacctcctg ctcggactac ccgttgtccg gctggcatac       360
     cccccctacc gcccgctgtt ctcgacctcc acgcatattt ccgcggcaga cctggggtgg       420
     gacctgtccg gccgggtcgc gctcttcccg ctgccgggcg gctttgtggg cggcgatacg       480
     gtagccttct tgttcggtgt tcccgatgtg tgtgccccgt gccctggtcc ccgtctgttt       540
     ctggacatgg gaaccaatgg cgagatggtt ctccagtgcg gtgatgtact gctgggcaca       600
     tcggccgccg ccggtcccgc tttcgagggg ggagggctcg cctgcggcat ggctgccctg       660
     ccgggggccg tgaacggcat catccgggat ggagaccgcg tgcgcgtcac gacgatcgga       720
     ggcggccagc ccctcggtat ctgcggttct gcggtgctgg acacggttgc gcttcttctg       780
     gaagaggggc ttctggactc caccggccgc cttctgccgc cggaagagat cgcgtcacct       840
     gtcggcgccc gcatgggaac ggtgggcggg gagcccgcgt tcattcttca tcgggatgcg       900
     gcgcggacca tctatctctc ccaggaggat atccgccagg tgcagctcgc caaggcggca       960
     atccgtgccg gcatagaggt cctgtgcgaa cgggcccgca tccggtgtga ggatattgaa      1020
     gaggttgtcc tgaccggctc tttcggcgcg gtactctcac cccggagcct aaaattcatt      1080
     ggaattttca cgggaaagat ggtacaaacg acccgtttcg tccgggaggg tgccctggcc      1140
     ggtgtcgaaa aggcactgac cgccccggag gggttcgagg ccgttgaccg actggcccgg      1200
     gcgctccggg tcatccccct ctcgggtacg cctgccttcg agaaacactt tctgaagcac      1260
     atcgacttcc cgtctcgcta a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page