(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE582

CP002031.PE582       Location/Qualifiers
FT   CDS_pept        627400..628764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0592"
FT                   /product="ResB-like family cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83455"
FT                   /protein_id="ADI83455.1"
FT                   /translation="MTTSDRGFLQALWDFFCSLKLAIFLLILLAATSIIGTIIPQQNPL
FT                   PPEYIAAIGGTGSMKFKVYSTLGFFDMYHSWWFILLLYLFTVNIVACSIKRLPRVWKTI
FT                   SEPTLVMDEGFERTLTLTHDFKKEGDAAALNEKMKVFLKSEFAEPVVTERDGEFHLFAQ
FT                   KSPYSRLGVYVVHLSIVIIFIGALLGSFFGYKAYVNIVEGSGASTVMSRKGVPIDLGFT
FT                   VKCEDFSVSFYDTGAPKEFKSLLTVIDGGKVVIDKRPVIVNEPLTYKGITFYQSSYGPA
FT                   DEGGLYHLTVRERKGGAPVRLSLSMGERKVLPDGSAVQLLEATDEIGRFIPQFRGPAVR
FT                   VAVEPKSGEPQAFIVFQNYPEFDVQRGADQIFTYEGADLKMFTGLQVAKDPGVWVVWLG
FT                   CTLMVVGCCMAFFMSHKRIWIRVRKGHVTLGGTANKNQPGFQLAFDTLVEKLKTL"
     ttgacaacca gcgatcgcgg cttcttgcag gcactgtggg atttcttctg ttccctcaag        60
     ttggcaatct tccttctcat tcttctagcg gcaacgtcca tcatcggtac gatcattccg       120
     cagcagaatc cgcttccccc cgagtacatc gcggccatag gcggcacggg aagcatgaag       180
     ttcaaggtct actcgaccct tggcttcttt gatatgtacc actcctggtg gttcattctc       240
     ctgctctatc tgttcacggt caacatcgta gcctgctcca tcaagcggct gccccgggta       300
     tggaaaacca tttccgagcc gacgctcgtc atggacgagg gctttgagcg gaccctgacg       360
     ctcacccatg atttcaagaa agagggtgat gcggctgccc tcaacgagaa gatgaaggtg       420
     ttcctcaaga gcgagttcgc cgagccggtg gtgaccgagc gggacggaga gttccacctc       480
     ttcgcccaga agtcgccgta cagcaggctg ggtgtttatg tggtgcacct gagcatcgtc       540
     atcatattca tcggtgccct gctcggatcg ttcttcgggt acaaggccta tgtgaatatc       600
     gtggaaggct cgggagcctc tacggtcatg tctcgcaagg gtgtgccgat tgatctcggc       660
     tttacggtca agtgtgagga cttttcggtt tcgttttacg acaccggggc acccaaagaa       720
     ttcaagagtc tcctcactgt catcgacggc ggcaaggtgg tcattgacaa acgccctgtc       780
     atcgtgaacg agccgctgac ctacaagggg ataacgtttt accagtcgag ctacggtcct       840
     gcggatgaag gtggcctcta tcacctcacc gtgcgcgagc gcaagggagg agcacccgta       900
     cggctttcgc tgtccatggg agagcggaag gtcctgcccg acggctccgc agtccagctc       960
     ctggaggcta ctgacgaaat cgggcgcttc attccccagt tccggggccc ggcggtgcgg      1020
     gtcgctgtgg agcccaagag cggcgagccc caggcgttca tcgtgttcca gaactatccg      1080
     gaattcgacg tccagcgtgg agcggaccaa atctttacgt atgaaggagc cgatctcaag      1140
     atgttcaccg gacttcaggt cgccaaagac ccgggcgtct gggtagtgtg gctgggatgc      1200
     accctgatgg tggttggctg ctgcatggcg ttcttcatgt cccacaagcg gatctggata      1260
     cgggttcgca aggggcacgt gaccctcggc ggcaccgcca acaagaacca gccgggattc      1320
     caactcgcct tcgacaccct tgtcgaaaaa ctgaaaactc tgtaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page