(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE583

CP002031.PE583       Location/Qualifiers
FT   CDS_pept        628786..629637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0593"
FT                   /product="ResC/HemX-like cytochrome c biogenesis membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83456"
FT                   /protein_id="ADI83456.1"
FT                   /translation="MTSSMLFNITTFTYLVSMLAFFAFLASRNRHVGMAGSLISYFGFI
FT                   VHTAAILLRWKESYDIGHGHAPLSNLYESVVFFAWTIVLIFGIIDMKYKYRVVGAFVMP
FT                   FALLGMAWAQLTLNSGIEPLVPALQSNWLLYHVVTCFLGYAAFAVACGISIMYLIKAGK
FT                   EDSSQSAQAGGIISMFPPTKILDDLNYKAIMIGFPLLTLGIITGAAWANYAWGTYWSWD
FT                   PKETWSLIVWFVYAAFLHARFTRGWVGKRAAILSIVGFAATIFCYLGVNLLLSGLHSYG
FT                   GG"
     atgaccagtt ccatgctgtt caacatcacg acgttcacct acctggtctc catgctcgct        60
     ttttttgcct tcctggcgag caggaatcgc cacgtgggaa tggcggggag tctcatttcc       120
     tattttggtt tcatcgtcca tacggctgcc attctgctcc gctggaaaga gtcctatgac       180
     atcgggcatg gccacgcccc cctgtcgaac ctctacgagt ctgtggtttt cttcgcctgg       240
     accattgttc tcatcttcgg catcattgac atgaagtaca agtaccgggt cgtgggcgcg       300
     ttcgtaatgc cttttgcgct cctcggcatg gcatgggccc agctgacgct caacagcggc       360
     atcgagcccc ttgttcctgc gctccagagc aactggctgc tctatcacgt cgtcacctgc       420
     ttcctgggct atgccgcctt tgccgttgcc tgcggcatct ccatcatgta tctgatcaag       480
     gcggggaagg aggattcgtc ccagtcggcg caggccggcg gaatcatctc catgttcccg       540
     cccacgaaga tcctggatga tctcaactac aaggcgatca tgatcgggtt cccgctgctc       600
     acgctcggca tcatcaccgg cgcggcatgg gccaactacg cctggggcac ctactggagt       660
     tgggacccga aggaaacctg gtcgctgatc gtctggttcg tgtatgccgc attcctgcat       720
     gcccgcttca ctcgcgggtg ggtcggaaag cgcgccgcca tcctttccat tgtgggattc       780
     gcggccacca tcttctgcta cctcggcgtg aacctccttc tctccggtct ccacagttac       840
     ggaggagggt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page