(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE586

CP002031.PE586       Location/Qualifiers
FT   CDS_pept        631827..632912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0596"
FT                   /product="NHL repeat domain lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83459"
FT                   /protein_id="ADI83459.1"
FT                   /translation="MNVLKLIRRFVGAAVLCALCAGCAGQQVREERRYFWPPLPERPRI
FT                   EWLGAYSSQNDFPKQGFASFMAAIAGEEQAMSLTKPLDVYADGQNRIYVADPGLRGVVV
FT                   FNMKERSVSMLGGPQAANQFNTPVSVTGDSQGNIYVSDAEKGGILVFDRFEVPRRFIDT
FT                   KATVTRNTDIAVDEKRQRILVVDAREHRIAILDMQGGLLSAFGKRGIEDGEFNFPVAVA
FT                   INRKGEIIVGDAMNARVQIFDQDGKFLRKFGRRGDGPADFQIMKGVAVDSEDHIYVTEG
FT                   KGHKLIIFGTNGEYLLTVGGLYSAITTGKQAPGGFVIPQGVFIDDKDVIYVVDQLNRRF
FT                   QVFQYISDDFLKRNPIPGWQE"
     atgaacgttc tgaagctcat ccgcaggttc gtcggtgcgg ccgtcctgtg cgccctgtgc        60
     gccggctgcg caggacagca ggtccgggag gagcggcgct acttctggcc gccgctgccc       120
     gagcgtccca ggatcgaatg gctcggtgcc tacagcagcc agaacgactt cccgaagcag       180
     ggattcgcgt cgttcatggc agccattgcc ggggaagaac aggccatgag cctgaccaag       240
     ccgctggatg tctatgcgga tggccagaac aggatttatg tggcagatcc gggccttcgc       300
     ggcgtggtgg tgttcaacat gaaagagcgg agcgtgtcga tgctcggcgg accccaggcg       360
     gctaaccagt ttaatacccc ggtttcggtc actggtgatt cccaggggaa tatttacgtt       420
     tccgatgcgg aaaagggggg gatactagtt tttgacagat ttgaggtgcc gcgtcgtttt       480
     atcgacacca aagctactgt cacgaggaac actgacatcg ccgtggatga aaagcgtcag       540
     agaattctcg tggtggatgc gcgcgagcac cggattgcca tcctcgacat gcaggggggg       600
     ctgctttccg cctttggaaa acgtggcatc gaagacggcg aattcaactt tcccgtggcg       660
     gtggccatca atcgcaaggg ggagatcatc gtaggcgatg ccatgaacgc ccgggttcag       720
     atcttcgatc aggacgggaa gtttctccgc aagttcgggc gccggggcga cgggccggcc       780
     gatttccaga tcatgaaagg cgtggccgtc gactcggagg atcatatcta tgtgaccgag       840
     ggaaaaggtc acaagctcat tatcttcggc accaacggcg agtatcttct caccgtgggc       900
     ggactctact ccgccatcac caccggcaag caggcccccg gcggattcgt cattcctcaa       960
     ggggtcttca ttgacgacaa ggacgtcatt tacgtggttg accaactcaa tcggcggttc      1020
     caggtgttcc agtacatctc cgacgatttc ctcaagcgca accccatccc gggatggcag      1080
     gagtaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page