(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE589

CP002031.PE589       Location/Qualifiers
FT   CDS_pept        636682..637683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83462"
FT                   /protein_id="ADI83462.1"
FT                   /translation="MADSITFSIIIPVKPGGTVRALDRLGSAEYPSSHMEVLVAEGTRP
FT                   SRQRNQAAAAAAGEILYFLDDDSLTSPDFLARAAAHLADPSIAAVGGPSLTPASDSRFQ
FT                   RAIGVVLASRLGGGGARNRYRATGSPRRTSERELILCNLAMRRDVFLAEGGLDERLYPN
FT                   EENELMDRISKRGMSLVHDPDLAVRRSQRPTFRAFVRQFFGYGRGRGEQTRIAGVRSVV
FT                   DFLPTVFLIYLLLLPVAPWAPCFLPAALYGAAVMVSALSGAVHSRLYAALPWLVVLYPT
FT                   LHLCYGAGLLKGLLAPRFRSGGGETAPVTIRCVKEFGTPWHLPAHGPREVPR"
     atggccgatt cgattacctt ttccatcatc attcccgtga agccgggcgg aaccgtccgt        60
     gccctcgatc gcctcggatc ggccgagtat ccctcctcgc acatggaggt cctggtggcc       120
     gaggggacgc ggccgagccg tcagcgtaac caggctgcag ccgctgcagc gggcgagata       180
     ctctattttc tggatgacga ctctctgacg tcaccggatt ttctggcgcg ggctgcggca       240
     cacctggccg atccatccat agccgccgtg ggcggcccgt cgctcacccc tgcatccgac       300
     agccgattcc agcgcgccat cggcgtcgtt ctggcatcgc ggctgggtgg gggcggggcg       360
     cgcaaccgct accgcgccac cggcagcccc cgccgcacga gcgagcggga actgatcctg       420
     tgcaacctgg ccatgcgccg ggatgtcttc ctggcggagg gggggcttga cgagcggctc       480
     taccccaacg aggagaacga actcatggac cggatctcga agcggggaat gagcctcgta       540
     cacgatccgg acctggctgt ccggcggagc cagcgaccca cgttccgggc gtttgtccgt       600
     cagtttttcg gctatggaag gggccgcggc gagcagaccc gcatagccgg tgtgcgctca       660
     gtggtggatt tcctgccaac ggtgtttctg atctacctgc ttctcctgcc ggtcgcgccc       720
     tgggctccct gtttcctgcc tgctgccctc tacggtgcgg cggttatggt gtcggccctg       780
     tcgggtgccg tgcattcgcg cctctatgcc gcattaccgt ggctcgttgt gctctatccg       840
     acactccacc tctgttatgg ggccggcctc ttgaaaggcc tgctggcacc ccgcttcagg       900
     tccggtggcg gggaaaccgc gccggtcacg atccgttgcg tcaaggagtt cggcactcct       960
     tggcatctgc ctgcccacgg tcccagggag gtcccgcgat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page