(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE6

CP002031.PE6         Location/Qualifiers
FT   CDS_pept        9060..10628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82869"
FT                   /protein_id="ADI82869.1"
FT                   /translation="MERHRTIDMSLRERRDILDLLERLKKEDLSPAEMDEIGSSLRKEG
FT                   RRALSPLFRCLRRETDPEMIARYAALLEFFEDDAWLDQLVAITLARRDLDDEGKSALLS
FT                   ILNEYGVDVSSPLFAPITDRAGGLRLTLPRLLDRGERGLVTFMEGLVTYTPEAQQAVVR
FT                   ELPLVDDRRVVELFRVLLGFDEPETLPTVIETLGRVRYPEAADLLRDFLAAAPDAYRAP
FT                   AERSLRRLAFLGFTPAGETPAPLPFAAAFTGTADASGYSCVMVARWTGPGIIDTLFMEL
FT                   HESEGMRDAWGWSGLSSEGFQDLLREHHVEDTLVAVDPAFAVLLVRDAIQRSIGSGFYL
FT                   PPEFYVRRSIFAEVDLTPVAYEPPFGEDEVAKACTPSRIAVGDDLIRDWFFDGWFIFNE
FT                   RVRLLADDLDRLEGDPFGRGDEAAVDRFLENWCRRYVAPRRERLVRRLLLAADLMVRSG
FT                   RECSLVEQSLAAARSIREELVPLHRQPFIRRWLLDLIEMVREARAEGYEFPPTRRDEEY
FT                   EGEWD"
     atggaacgtc accgtaccat cgacatgagc ctgcgggagc gtcgcgatat tctcgacctt        60
     ctggagcgct taaagaaaga ggatctgtcc cccgccgaga tggacgagat cggttcctcg       120
     ctccgtaagg agggacgccg ggccctttcc cctctcttcc ggtgcctgcg ccgcgagacg       180
     gacccggaga tgatcgcccg ctacgcggca ctgctggaat tcttcgagga cgacgcctgg       240
     ctcgaccagc tcgtggccat cacccttgcc cgccgcgacc tggacgatga ggggaaatcg       300
     gcccttctgt ccatcctgaa tgagtacggc gtggacgtct cctcccccct cttcgcaccg       360
     atcacggatc gggcgggcgg cctgcgcctc actctcccgc ggcttctgga caggggtgag       420
     cggggactcg tcacgttcat ggaggggctt gtcacctaca cgcccgaggc ccaacaggcc       480
     gtggtgcgtg agctgccgct cgtcgacgac cggagggttg tggagctctt ccgggtcctg       540
     ctgggctttg atgagcccga gaccctgccg acggtcattg agaccctcgg ccgcgtccgg       600
     tatccggagg ccgccgatct gctgcgggat tttctcgccg ccgcgccgga cgcataccgg       660
     gccccggctg agcggagtct gcgtcggctt gcttttctgg ggttcacgcc ggcgggtgaa       720
     actcctgctc ctcttccctt tgcggcggcc ttcaccggca ccgctgatgc gtccggctac       780
     tcatgcgtga tggtcgctcg ctggacagga cccggcatta tcgataccct gttcatggaa       840
     ctccatgaga gcgaggggat gcgcgacgcc tggggatgga gcggcctctc ctccgaagga       900
     ttccaggatc tgctgcggga acaccatgtg gaggacaccc ttgtggcggt ggatcccgcc       960
     tttgcggtgc tgttggtgcg ggatgccatc cagaggagca tcgggagcgg gttttacctc      1020
     ccccccgaat tttacgtccg ccgttcgatc tttgctgagg tggatctgac gccggtcgcc      1080
     tatgagcccc ccttcgggga ggatgaggtc gcgaaggcct gcaccccttc ccggatcgcg      1140
     gtgggagacg atctcattcg ggattggttt ttcgacgggt ggttcatctt caacgagcgg      1200
     gtccggcttc ttgccgatga cctggaccgg ctggaggggg atcccttcgg ccggggggat      1260
     gaagccgccg ttgaccggtt cctggaaaac tggtgccggc gttatgtggc gccgcgccgg      1320
     gagcggcttg tccggcgcct cttgcttgcc gctgatctga tggtgcgcag cggccgggag      1380
     tgctcgctgg tggagcagag cctggcagca gcccggagca tccgggagga actggtcccg      1440
     ctccaccgtc agccgttcat caggcgctgg ttgctggacc tgatcgagat ggtcagggag      1500
     gcccgggccg agggatacga gttcccacct acgcgtcggg acgaggagta tgaaggggag      1560
     tgggactag                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page