(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE607

CP002031.PE607       Location/Qualifiers
FT   CDS_pept        654807..655061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0617"
FT                   /product="protein of unknown function DUF3343"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83480"
FT                   /protein_id="ADI83480.1"
FT                   /translation="MVREGERVAIFNSIHRVMKAEKLLKGQGMVILLIPAPRDLHADCG
FT                   LAIRYASADAVAVESSLREADLEPEEIHEKTAVGYSRLP"
     atggttcgcg agggagagcg cgttgcgatt ttcaactcga tccaccgcgt catgaaagcc        60
     gaaaaactcc tcaaaggcca ggggatggtg atacttctca ttcccgcgcc ccgcgacctc       120
     cacgctgatt gcggtcttgc catccgctat gcatcggccg atgccgtagc ggttgagtcg       180
     agcctgcggg aggccgatct cgagcccgag gagatccacg aaaagacagc tgtcggctac       240
     agccggttgc cgtaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page