(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE623

CP002031.PE623       Location/Qualifiers
FT   CDS_pept        671907..672071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83496"
FT                   /protein_id="ADI83496.2"
FT                   /translation="MKRKPEANKLCLSCRRPCKQAAAVVISSCPRYYPGPKIKRENWKQ
FT                   LEFDLISLH"
     atgaaacgga agcccgaagc caataagctc tgtctttcct gccgccgccc gtgcaagcag        60
     gccgctgcgg ttgtcatttc ctcctgcccc cgctactatc ccggtcccaa gattaagcgg       120
     gagaactgga aacagttgga gttcgacctt atttcgctcc actag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page